KEGG   Acinetobacter baumannii AB307-0294: ABBFA_001794Help
Entry
ABBFA_001794      CDS       T00795                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvatedehydrogenase complex(E2)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
abb00010  Glycolysis / Gluconeogenesis
abb00020  Citrate cycle (TCA cycle)
abb00620  Pyruvate metabolism
abb01100  Metabolic pathways
abb01110  Biosynthesis of secondary metabolites
abb01120  Microbial metabolism in diverse environments
abb01130  Biosynthesis of antibiotics
abb01200  Carbon metabolism
Module
abb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:abb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABBFA_001794
   00020 Citrate cycle (TCA cycle)
    ABBFA_001794
   00620 Pyruvate metabolism
    ABBFA_001794
Enzymes [BR:abb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     ABBFA_001794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ACJ58166
LinkDB All DBs
Position
complement(1927414..1928904)
Genome map
AA seq 496 aa AA seqDB search
MEEGTIAQWLIKEGDSFNKGDEICEIETTKIVNVLEAPFAGTLRKILAKDGDTLPVGGLI
AVCADSEISNAEIEKFIASLGGSAAKAPEASSEQSKSETFAPVAEKAEQPQSVAASAPAP
TKVAKGDYAVPESLQGYQTSDELFATPHALKLAEKHNVNLAKVRGSGREGRISVQDIQKA
VQAAGGQWPDVKQQTQAKVIKSTADDSQVLATPVARRLAKQWGINLNDCRVSGTRGRVCK
EDVEAVYYRNNPTSVNEQSAQCAAQPQSTITTVAMNGMRKAIASRLQAAKRNAPHFRLVV
DLNVEALQKLRKQINETVPQVKLSINDMLIKAAAAALIKVPEVNVQFDEATQSILQFSQA
DISVAVAIPNGLITPIVKAANQKSLAQISDDMRDLATRAKTGKLQPDEFQGGSFSISNLG
MLGIKQFDAIINPPQGAIMALGASESRAVVENGNVVVREIVTATLSCDHRVIDGAVGAKF
LASFKQFVENPALILV
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaggcacgatcgcccaatggttgattaaagagggtgatagctttaataagggc
gatgaaatttgtgaaattgaaaccacaaaaatcgtcaatgtattagaagcaccttttgct
ggaacgctccgtaaaattttagcgaaagatggtgatactttacctgttgggggtcttata
gccgtatgtgctgatagtgaaatttctaatgcagaaattgaaaaatttattgcatcacta
ggtggttcagcagctaaggcccctgaagcatcttcggaacaaagtaaatcggaaacattt
gcacctgttgctgaaaaagccgaacaaccacagtccgtagctgcaagtgctccagctcct
acaaaggtagcgaaaggtgactacgctgtaccagagtcattacaaggctatcaaacatct
gatgagttgtttgcaacgccacatgcgttaaagcttgcagaaaagcacaatgtgaacttg
gcaaaagtcaggggttctggtcgtgaaggacgtattagtgttcaagacatccagaaagct
gtgcaggctgctggtggtcagtggcctgatgttaagcagcaaactcaagctaaagtgatt
aaatctacagccgatgatagccaagttttagcgacacctgtagcacgtcgtttagcaaaa
caatggggtattaacctaaatgactgccgtgtttcaggtactcgtggccgtgtctgcaaa
gaagatgttgaagcagtttactatcgtaacaatccaacgtcggtaaatgaacaatctgct
caatgtgcagctcaaccacaatcaacaattacgactgtggcgatgaatgggatgcgtaaa
gcgattgcttcacgcttacaagctgcaaaacgtaatgcaccgcatttccgcttagtggtc
gatctcaacgtagaggctttgcaaaaattacgtaagcagattaatgaaacggttcctcaa
gtcaaactttctattaatgacatgctaattaaagcagctgctgcggcactgattaaagtg
cctgaggtgaatgttcaatttgatgaggcgactcaatcaattttacagttctctcaagcg
gatatttcggtggccgtagcgattccaaacggtttaattacacccattgtaaaagcagcg
aatcagaagtctttagcacaaatttccgatgacatgcgtgatttggcaacgcgtgctaag
actggcaagttacaacctgacgagtttcagggaggcagctttagcatttcaaatttagga
atgttaggcattaaacagttcgatgccattattaacccaccgcaaggtgcaattatggca
ttaggtgcttcggaatctcgcgctgttgtcgaaaatggcaatgtagtggttcgtgagatt
gtcacagcgacgttgtcatgcgatcaccgagttattgatggcgcagttggggcgaaattc
ttggccagctttaagcagtttgttgaaaaccctgctttaattttggtgtag

DBGET integrated database retrieval system