KEGG   Acinetobacter baumannii AB307-0294: ABBFA_00762
Entry
ABBFA_00762       CDS       T00795                                 

Gene name
lpdG
Definition
(GenBank) Dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
abb00010  Glycolysis / Gluconeogenesis
abb00020  Citrate cycle (TCA cycle)
abb00260  Glycine, serine and threonine metabolism
abb00280  Valine, leucine and isoleucine degradation
abb00310  Lysine degradation
abb00380  Tryptophan metabolism
abb00620  Pyruvate metabolism
abb00630  Glyoxylate and dicarboxylate metabolism
abb00640  Propanoate metabolism
abb01100  Metabolic pathways
abb01110  Biosynthesis of secondary metabolites
abb01120  Microbial metabolism in diverse environments
abb01200  Carbon metabolism
Module
abb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
abb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:abb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ABBFA_00762 (lpdG)
   00020 Citrate cycle (TCA cycle)
    ABBFA_00762 (lpdG)
   00620 Pyruvate metabolism
    ABBFA_00762 (lpdG)
   00630 Glyoxylate and dicarboxylate metabolism
    ABBFA_00762 (lpdG)
   00640 Propanoate metabolism
    ABBFA_00762 (lpdG)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ABBFA_00762 (lpdG)
   00280 Valine, leucine and isoleucine degradation
    ABBFA_00762 (lpdG)
   00310 Lysine degradation
    ABBFA_00762 (lpdG)
   00380 Tryptophan metabolism
    ABBFA_00762 (lpdG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abb04147]
    ABBFA_00762 (lpdG)
Enzymes [BR:abb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     ABBFA_00762 (lpdG)
Exosome [BR:abb04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   ABBFA_00762 (lpdG)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox GIDA AlaDh_PNT_C FAD_binding_2 FAD_oxidored HI0933_like NAD_binding_8 Pyr_redox_3 3HCDH_N DAO Thi4 FAD_binding_3 2-Hacid_dh_C Lycopene_cycl
Other DBs
NCBI-ProteinID: ATY43212
LinkDB
Position
800723..802156
AA seq 477 aa
MSQQFDLVVIGGGPGGYEAAIRAAQLGFKVACIEKRIHNGKPSLGGTCLNVGCIPSKALL
DSSHRYEDTVHHLADHGITTGEVNFDLAKLLARKDKIVDQLTGGIDQLLKGNGIEWLKGT
GKLLAGKKVEFVPHEGETQILEPKYVILASGSVPVNIPVAPVDQDIIVDSTGALNFPEVP
KRLGVIGAGVIGLELGSVWRRLGAEVVVFEAMDAFLPMADKALSKEYQKILTKQGLDIRI
GAKVSGTEVNGREVTVKYTQAGEDKEQTFDKLIVCVGRKAYAEGLLAEDSGIKLTERGLV
EVNDHCATSVEGVYAIGDLVRGPMLAHKAMEEGVMAVERIHGHAAQVNYDTIISVIYTHP
EAAWVGLTEEQAKEKGHEVKTGQFGFAVNGRALAAGEGAGFVKFVADAKTDRLLGMHVIG
PAASDIVHQGMIALEFVSSVEDLQLMTFGHPTFSEVVHEAALAVDGRAIHAIQRKRK
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgtctcaacaatttgatcttgttgtcattggcggtggtcctggtggttatgaagctgcg
attcgcgctgctcaactaggcttcaaagtcgcttgtattgaaaaacgtattcacaacggt
aagccttctttaggtggtacttgcttaaacgtaggttgtatcccttctaaagctttgctt
gattcttctcatcgttatgaagatacagtgcatcatttagctgatcacggtattacaact
ggtgaagtgaatttcgatcttgcaaaacttcttgctcgtaaagacaaaattgttgaccaa
ttaactggcggtattgatcaattgcttaaaggcaacggtatcgagtggttaaaaggtaca
ggtaaattacttgctggtaaaaaagttgagtttgttccacatgaaggtgaaactcaaatt
ttagaacctaaatacgtaattcttgcgtctggttctgtgcctgtaaatattcctgtagct
cctgtagatcaagatattattgttgattcaactggcgcattaaacttccctgaagtacct
aagcgtttaggtgtaattggtgcgggtgtaatcggtttagaacttggttcagtatggcgt
cgtcttggtgctgaagttgttgtatttgaagcaatggatgcattcttgccaatggctgat
aaagcactttctaaggaatatcaaaaaatcttgactaaacaaggtttagatatccgcatt
ggtgcgaaagtatctggtactgaagtaaacggtcgtgaagtgactgttaaatacactcaa
gctggtgaagacaaagaacaaacgtttgataagttaatcgtttgtgttggccgtaaagct
tatgctgaaggtttattggctgaagattcaggtattaaattaactgaacgtggtttagtt
gaagtaaatgatcactgtgcaacttctgtagaaggtgtatatgcgattggtgacttagta
cgcggtccaatgcttgctcataaagcaatggaagagggcgtaatggctgttgaacgtatt
catggtcatgcagctcaagtaaactatgacacaatcatttctgttatctatacacaccct
gaagcggcgtgggttggtttaactgaagagcaagctaaagaaaaaggtcatgaagtaaaa
actggtcaattcggttttgctgtaaatggtcgtgctttagctgctggtgaaggtgcaggt
tttgttaagtttgttgctgatgcaaaaactgaccgtttattaggtatgcatgtgattggg
cctgcggcatctgatatcgttcaccaaggtatgatcgcacttgaatttgtatcttctgtt
gaagatcttcagttgatgacttttggtcacccaacattctctgaagttgttcatgaagct
gcacttgctgtagatggtcgtgcaattcacgcgattcaacgtaagcgtaaataa

DBGET integrated database retrieval system