KEGG   Acinetobacter baumannii AB307-0294: ABBFA_01264
Entry
ABBFA_01264       CDS       T00795                                 

Gene name
mnmG
Definition
(GenBank) tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG
  KO
K03495  tRNA uridine 5-carboxymethylaminomethyl modification enzyme
Organism
abb  Acinetobacter baumannii AB307-0294
Brite
KEGG Orthology (KO) [BR:abb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:abb03016]
    ABBFA_01264 (mnmG)
   03036 Chromosome and associated proteins [BR:abb03036]
    ABBFA_01264 (mnmG)
Transfer RNA biogenesis [BR:abb03016]
 Eukaryotic type
  tRNA modification factors
   Other tRNA modification factors
    ABBFA_01264 (mnmG)
 Prokaryotic type
    ABBFA_01264 (mnmG)
Chromosome and associated proteins [BR:abb03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    ABBFA_01264 (mnmG)
SSDB
Motif
Pfam: GIDA GIDA_assoc FAD_oxidored Pyr_redox_2 FAD_binding_2 DAO HI0933_like AlaDh_PNT_C Pyr_redox Thi4 Pyr_redox_3 NAD_binding_9
Other DBs
NCBI-ProteinID: ATY43700
LinkDB
Position
1375851..1377731
AA seq 626 aa
MHYPKVYDVIVIGGGHAGTEAALAAARMGRQTLLLTHNIETLGQMSCNPAIGGIGKSHLV
REIDALGGAMALAADKGGIQFRILNSRKGAAVRATRAQADRVRYKAAIRETLENQANLDI
FQQAADDLIVEGDTVKGVVTQMGIRFDAKTVVLTTGTFLGGVIHVGLEKSSGGRAGDPPS
IALAQRLRELKLPVGRLKTGTPPRIDARSVDFSVMTPQPGDFPSPVMSFMGDVSMHPEQV
NCYITHTNEKTHDIIRGGLDRSPMYTGVIEGVGPRYCPSIEDKIHRFSDKDSHQVFLEPE
GLDTHELYPNGISTSLPFDVQFELVRSIRGMENAHILRPGYAIEYDYFNPQALKFTLETK
AINGLYFAGQINGTTGYEEAGAQGLLAGLNAARRAWEQEEWTPKRDQAYMGVLVDDLITL
GTKEPYRMFTSRAEYRLMLREDNADQRLTTIGRELGLVDDVRWAAYCEKMEAVERETSRL
QHVWAAPNNPMGKKFVEMTGADLSKECSAIDLLKRPNINFGQIAELTGSEVSQQVGEQIE
IAVKYEGYINRQHEDVAQLKRLEETKIPADFDYDVVSGLSREITQKLKTVRPETLAQASR
IPGVTPAAVQLVMITIRKNNMTKKTA
NT seq 1881 nt   +upstreamnt  +downstreamnt
atgcactatcctaaagtttatgatgttatcgttatcggtggcggtcacgcaggtacggaa
gcggcgcttgctgctgcgcgtatgggacgacagactttgcttttgacccataacattgag
actttgggtcagatgagctgtaaccctgcaattggtggcattggtaagtcgcacttagtt
cgtgaaattgatgcgcttggcggtgcaatggctttagctgccgataaaggcggtattcaa
ttccgtattttaaactcgcgtaaaggtgctgcagtacgtgcaacgcgtgctcaggctgac
cgtgttcgctataaagctgcgattcgtgagaccttagaaaaccaagcaaatcttgatatt
ttccaacaggcggctgatgacctgattgttgaaggcgatacagttaagggtgttgtgacc
caaatgggtatccgctttgatgcaaaaactgttgtgttaactactggtacattcttgggc
ggtgttattcacgttggtttagagaaatcaagcggcggtcgtgctggtgatcctccttct
attgctcttgctcagcgtcttcgtgagttgaaattaccggtaggccgtttaaaaacaggt
acacctccacgtattgatgcacgttcagttgatttttctgttatgacaccacaaccaggc
gacttcccgtctccggtaatgtcgttcatgggtgatgtgtctatgcacccagaacaagtg
aactgctatatcacgcatactaacgaaaaaactcatgacattattcgtggtggcttagac
cgttcaccaatgtataccggtgtcattgaaggggtaggtccacgttactgtccttcaatt
gaagataagattcatcgtttctctgataaagactcgcatcaggtattcttagagccagaa
ggccttgatacacatgagctttatccaaatggtatttcgacttcattaccatttgatgtt
cagtttgaacttgtgcgctcgattcgcggtatggaaaatgcccatatcttacgtccgggt
tatgcaatcgaatatgactatttcaacccgcaagctttgaaatttaccctagaaaccaaa
gcaattaacggcttgtattttgcagggcaaattaatggtactaccggttatgaagaagcg
ggtgcccaaggtttacttgcaggcttgaatgctgcacgccgtgcatgggaacaagaagaa
tggacacctaaacgtgaccaagcttatatgggtgtattggttgacgacttgattacttta
ggtacgaaagagccataccgtatgttcacttcacgtgcggaatatcgtttgatgttacgt
gaagataatgccgatcaacgtttaacaactattggtcgtgagcttggtttggttgatgat
gttcgttgggcggcttattgcgaaaaaatggaagcagttgagcgcgaaacatctcgttta
caacatgtatgggcggcacctaacaacccaatgggtaaaaagtttgttgaaatgacaggt
gctgacttaagtaaagaatgtagtgcgattgacttgcttaaacgtcctaatattaatttt
ggccaaattgcggaacttacaggttctgaagtatcacagcaagtcggtgagcaaattgaa
attgctgttaaatatgaaggttatatcaaccgtcagcatgaagatgtggctcaattaaaa
cgtcttgaagaaactaaaattcctgctgattttgattatgacgtcgtttcaggtttatct
cgcgaaattactcagaagttgaaaacagttcgtccggaaacattagctcaagcgagccgt
attcctggtgttaccccagccgctgttcagcttgtaatgatcacgattcgtaaaaataat
atgacgaaaaaaacggcttaa

DBGET integrated database retrieval system