KEGG   Acinetobacter baumannii AB307-0294: ABBFA_01421
Entry
ABBFA_01421       CDS       T00795                                 

Gene name
nasD_1
Definition
(GenBank) Nitrite reductase [NAD(P)H]
  KO
K00362  nitrite reductase (NADH) large subunit [EC:1.7.1.15]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
abb00910  Nitrogen metabolism
abb01100  Metabolic pathways
abb01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:abb00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    ABBFA_01421 (nasD_1)
Enzymes [BR:abb01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.15  nitrite reductase (NADH)
     ABBFA_01421 (nasD_1)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Fer2_BFD NIR_SIR Rubredoxin_C Pyr_redox_3 NIR_SIR_ferr DAO HI0933_like GIDA AlaDh_PNT_C Pyr_redox_dim NAD_binding_8
Other DBs
NCBI-ProteinID: ATY43857
LinkDB
Position
1553031..1555577
AA seq 848 aa
MKLVMIGHGMVGHKFIEAILEKADDELEITILAEEPRIAYDRVHLTEYFSGKSAKDLSLA
RFDFADAYGIDLRLNTKAVAIDTTAQTVTTNHGDVISYDKLVLATGSYAFVPPIPGNDRE
NCFVYRTIEDLDAIRAASLKAKTGVVIGGGLLGLEAAKALRDLDLETHVVEFAPRLMAVQ
IDDLGGKVLRRKIEDLGVKVHTQKATQSIESGVNTTHVMKFADGSELETDVILFSAGIRP
RDELARNSGLAIGERGGIVINDYCQTSDQNIYAIGECALWQNKIYGLVAPGYDMARIAAK
HILDEECHCFAGADMSTKLKLMGVDVASVGDAHAMTPGALSYFYADEHALVYKKIVVNAD
KTKLLGAVLVGDAKEYNDLLQMMLNGLALPEVPESLIMPGFEQSAAKSGGSGVDLLPDSA
TICSCNNVSKADICQAISDGSTSLGALKKCTKAATACGGCAPLVTQVLKSELQRQGVTVN
NHICEHFPYSRQELYHLVRVNEIKTFDDLIHQHGHGLGCDICKPAAANILASCWNDFVLK
PSHAGLQDSNDYYLGNIQKDGSYSIVPRMAGGEVTPDGLIAIGQIAKKYNLYTKITGGQR
VDMFGAQVHELPFIWEELNAAGFESGHAYGKSLRTVKSCVGSTWCRYGVDNSVGLAIELE
NRYKGLRSPHKLKMAVSGCTRECAEAQGKDVGVIATEKGWNLYVCGNGGMKPRHAELLAS
DLDKETLIRYIDRFFMFYIQTADRLQRTSVWRDNMEGGLDYLKSVIVDDSLGLAAELERR
MEHIIGTYQDEWRTAVENPEVRKRFQTYINAGANEQADPHIQFTTERGQIRPLTEAERSE
DRIPMVEA
NT seq 2547 nt   +upstreamnt  +downstreamnt
atgaaattggtaatgattggtcatggtatggtgggccacaaattcatcgaagccatttta
gaaaaagcagatgatgaattggaaatcacgattcttgcagaagaacctcgtatcgcatat
gaccgcgtacatttgactgaatacttctcagggaaatcggcaaaagatttatctttagca
cgctttgattttgccgatgcgtatggcattgacctgcgtttaaatactaaagcagtggcg
attgatacgactgcacaaaccgtaacaaccaatcatggtgatgtgattagctatgacaag
ttggtgctggcgactggttcatatgcatttgttccgccaattccgggtaatgaccgcgag
aactgttttgtttaccgtaccattgaagatctagatgccattcgtgcagcaagtttaaag
gctaaaacaggcgtagtaattggcggtggtttacttggacttgaggcagccaaagcatta
cgtgatttagatttagaaacacacgttgttgagtttgcaccacgtttgatggcagttcaa
attgatgacttagggggcaaggttttacgccgtaaaattgaagatttaggtgtaaaagtc
catacacaaaaagcgactcagtctattgagtctggggtaaataccactcatgtgatgaag
tttgccgacggtagtgaactcgaaactgatgtgatcttattctctgcggggatccgccca
cgggatgaattagcgcgcaacagtgggcttgcgattggtgagcgtggcggtattgtaatt
aatgattattgccaaacatcggatcaaaacatttatgccattggtgaatgtgcgctttgg
caaaataaaatttatggcttggttgcaccgggctatgacatggcgcgtattgcagcaaaa
cacattttagatgaagagtgtcactgcttcgctggcgcagacatgagcaccaagttgaag
ttgatgggcgttgatgttgcttctgttggtgatgcacatgctatgaccccaggtgcatta
agctatttctatgcagatgaacatgcgctggtttataaaaagattgttgtaaatgccgac
aaaaccaagttgcttggcgcggttttagtgggcgatgccaaagaatacaacgacctttta
caaatgatgttgaatggtctggctttaccggaagtgcctgaaagtttaatcatgccgggt
tttgagcaatcagcagcaaaatctggtggtagcggagtcgatttgctgccagacagtgcg
actatttgttcatgtaacaacgtatcaaaagcggacatctgccaagcaattagtgatggt
tcgacctctttaggtgcattaaagaaatgcaccaaagcagcaacagcatgtggtggttgt
gcaccattagtgactcaagtattgaagtctgagttacaacgtcaaggtgtgactgttaat
aatcacatttgcgaacactttccttactcgcgtcaagagttgtatcacttggttcgtgtc
aatgaaatcaagacatttgatgatttaattcatcaacatggtcatggtttaggttgtgat
atttgtaaaccggcggcagcaaatattttggcctcttgctggaatgatttcgtacttaag
ccaagtcatgcaggcctgcaagacagtaacgactactacctaggtaacattcaaaaagat
ggctcttactcaattgtaccgcgtatggcaggcggagaagtcactccggatggcttaatt
gcgattggtcaaattgcgaagaaatataacttgtacaccaaaattactggtggtcaacgt
gttgatatgtttggtgcgcaagttcatgagcttccatttatttgggaagagttaaatgct
gcgggctttgagtctggtcatgcctatggtaagtcgttgcgtacagtgaaatcttgtgta
ggtagcacttggtgtcgttacggggtagataactcggttggtttagcgattgaacttgaa
aaccgctacaaaggtttgcgttcaccacataaattgaaaatggcagtgtctggctgtaca
cgtgagtgtgcggaagcgcaaggtaaagatgtaggcgtgattgccactgaaaagggttgg
aacctttatgtatgtggtaacggtggtatgaaaccgcgtcatgcagaattacttgcatct
gacctcgataaagaaacacttattcgttatatcgaccgtttctttatgttctacattcaa
acggcagaccgtttacaacgtaccagtgtatggcgtgacaacatggaaggcggtctagac
taccttaaatctgtgatcgttgatgactctcttggtttagctgccgagcttgagcgccgt
atggaacacattattggtacatatcaagacgaatggcgtacagctgtcgaaaacccagaa
gttcgtaaacgcttccagacttatatcaatgcaggagcaaatgaacaagctgatccgcac
attcaatttacaactgaacgtggtcaaatccgcccattaactgaagctgaacgttcagaa
gatcgcattccaatggttgaagcataa

DBGET integrated database retrieval system