KEGG   Acinetobacter baumannii AB307-0294: ABBFA_01753
Entry
ABBFA_01753       CDS       T00795                                 

Gene name
sdhA_2
Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
Organism
abb  Acinetobacter baumannii AB307-0294
SSDB
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 HI0933_like FAD_oxidored DAO GIDA Trp_halogenase Lycopene_cycl NAD_binding_8 Pyr_redox_3
Other DBs
NCBI-ProteinID: ATY44189
LinkDB
Position
complement(1908754..1910487)
AA seq 577 aa
MENKYLEFDIVVIGGGTAGPMAAIKAKQENPNLKVLLIEKANVKRSGAISMGMDGLNNAV
IPGYATPEQYTKEITIANDGVVNQTTVYAYAKHSFTTIQQLDQWGIKFEKDETGEFAVKK
VHHMGAYVLPMPEGHDVKKVLYRQLKRAQVKINNRIVTTKLLKNEQGAINGVLGFDCRSG
DFYVIKTKAAILCCGAAGRLGLPASGYLMGTYENPTNAGDGYAMAYHAGAELANLECFQI
NPLIKDYNGPACAYVTGPLGGYTANSKGERFIECDYWSGQMMWEFYQELESGNGPVYLKV
DHLAEETIQTIEEILHTNERPSRGRFHEGRGTNYRQDMVEMHISEIGFCSGHSASGVWVN
EKAETSVKGLYSAGDMAAVPHNYMLGAFTYGWFAGVNAAQYVNAVEDSELNQSEIEAEKA
RIFAPLNCSEGLPPEQVEYKLRRFVNDYLQPPKTRQKMEIGLKRFEEIKQDIKRISARNP
HELMRAAEVSFIRDCAEMAARASLFREESRWGLYHYRADFPQKNNSDWFCHAHLKKDEYG
NMVSFKKPIEPYVVPINQDEAVSYDRLRIQKDVALAD
NT seq 1734 nt   +upstreamnt  +downstreamnt
atggaaaataaatatcttgagttcgatattgtggtgattggtggtggaactgcagggccg
atggctgcgattaaagccaaacaagaaaacccgaatttaaaagtcttgctcattgaaaaa
gcgaatgtaaaacgtagtggggcgatttcaatgggaatggatggactgaataatgctgtt
attccgggctacgcaacacctgagcaatacaccaaagaaattaccattgctaatgatggg
gtagttaaccaaaccactgtatatgcatatgcgaagcatagtttcacaaccattcaacag
ctcgatcaatggggtattaagtttgaaaaagatgagactggcgaatttgcagtaaaaaaa
gtacatcacatgggggcatatgttttaccaatgcccgaaggccatgacgttaaaaaagtt
ttatatcgtcagttaaagcgtgctcaagtcaaaattaataatcggattgtcactacgaag
cttctaaaaaatgagcaaggtgcaatcaatggtgtacttggttttgactgtcgtagtggt
gacttttatgtcattaaaacgaaagctgccattttatgttgtggtgccgcagggcgttta
ggtttgccagcttccggctatttaatgggcacttatgaaaacccaaccaatgcaggtgac
ggctatgcaatggcataccatgcaggtgctgagcttgctaacttagaatgcttccagatt
aatccattgattaaagactataacggcccagcttgtgcctatgtgactggtcctttagga
ggttataccgctaacagtaaaggtgaacgtttcattgaatgtgactactggagtggtcaa
atgatgtgggagttttaccaagaactggaaagtggtaatggtcctgtttatttaaaagta
gatcatctggccgaagaaaccattcaaaccatcgaagaaatcttgcataccaatgagcgc
ccaagccgtggacgttttcatgagggccgaggaaccaattaccgtcaagatatggtggaa
atgcatatttcagaaattggtttctgtagcgggcacagcgcttctggcgtatgggtcaat
gaaaaagctgagacttcagttaaaggattatacagtgctggcgatatggctgctgtacct
cacaattatatgcttggtgcatttacctacggatggtttgcaggtgtaaatgccgcgcaa
tacgtgaatgcagttgaagatagtgaattaaaccaaagcgaaatagaagcagaaaaagct
cgaatatttgcgccactgaattgctcagaaggtttacctccagagcaagtggaatataag
ctgcgccgttttgtaaatgactatttgcaaccccctaaaactcgccaaaaaatggaaatt
gggctcaagcgttttgaagaaatcaaacaagatattaagcgaatttctgccagaaaccca
catgagctgatgcgtgccgctgaagtttcttttattcgagattgtgcggaaatggcagct
agagcttcactgtttagagaggaaagccgctggggactgtaccactatagagcagatttt
cctcaaaaaaataactcggattggttctgtcacgcgcatttgaaaaaagatgaatacggg
aacatggtcagtttcaaaaagccaatcgagccttatgtggttccgattaatcaagatgaa
gctgtgtcgtatgaccgtttacgcattcaaaaagatgttgctctagcagactaa

DBGET integrated database retrieval system