KEGG   Acinetobacter baumannii AB307-0294: ABBFA_02175
Entry
ABBFA_02175       CDS       T00795                                 

Gene name
hcnB
Definition
(GenBank) Hydrogen cyanide synthase subunit HcnB
  KO
K22549  D-hydroxyproline dehydrogenase subunit alpha [EC:1.5.99.-]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
abb00330  Arginine and proline metabolism
abb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    ABBFA_02175 (hcnB)
Enzymes [BR:abb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.99  With unknown physiological acceptors
    1.5.99.-  
     ABBFA_02175 (hcnB)
SSDB
Motif
Pfam: Pyr_redox_2 FAD_binding_2 FAD_oxidored HI0933_like Thi4 GIDA DAO NAD_binding_8 AlaDh_PNT_C Pyr_redox_3 FAD_binding_3 NAD_binding_9 Pyr_redox K_oxygenase Lycopene_cycl
Other DBs
NCBI-ProteinID: ATY44610
LinkDB
Position
complement(2348407..2349669)
AA seq 420 aa
MEKQYDVVVVGAGPAGLSAAIAAAESGGRILILDNNPQAGGQIWRAGPIFPVPEMAQQKY
QQIKAHSNIEFMFGAKIVAAPFAGQLLVERPHDSLNLSYRQLILCTGARELFLPFPGWTL
PGVTGAGGLQALIKAGTPVKNERIVIAGSGPLLLASADTAKKAEAQVLYVAEQAASSSVR
KFALQLWRWPSKVIQALSLPHRLYQPDSYVVEAIGQERLERVRLQTPKGIIEIECDRLAC
GFGLVPNTQLGQLMGCQIKGNAITVDDYQCTSQPQVWAAGECTGFGGSELAMVEGSIAGY
AAIGQNEKARQLFAQRQRYRLFAHLLEKSFKLRAELKTLARPETIFCRCEDVTFDKVAER
KSWIDAKLHTRCGMGACQGSTCATAAACLFDWQLPNSRPPLLPTRVKSLMAMSTSPLNQK
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggaaaaacaatacgatgtggtggttgtcggtgctgggcctgcagggttgtcagctgct
attgcagccgccgaaagtggcgggcgaattttaatattggataataacccacaggcgggc
ggtcaaatctggcgggccggtccgatttttcctgtacctgaaatggcgcagcagaaatat
caacaaattaaggctcattctaatattgaatttatgtttggtgcgaaaattgtcgccgca
ccttttgcaggccaattgcttgttgagcgacctcacgacagcctaaacttgtcttatcgc
cagcttatattgtgtacgggagcaagagaactgtttttgccttttcccggttggacttta
cctggcgtaacaggggcaggtggtttgcaagccttaattaaagcaggcacacctgtcaaa
aatgaacgcattgtgattgcgggctccggacccttacttttagcaagtgcggatacggca
aaaaaagcagaggctcaagttctctatgttgccgaacaggcggcttcatcttccgttcgt
aaatttgcactgcaactttggcgttggccttcgaaagtaatacaagcgttatctttacct
catcgtttatatcaacctgacagttatgtggttgaggcgattggtcaggagcgtcttgaa
cgagtaaggctacaaacgccgaagggaatcattgaaattgagtgtgatcgactcgcgtgc
ggatttggcttagtcccgaatactcaattagggcagttaatgggttgtcaaattaagggc
aatgcgattacggtcgatgactatcaatgtacatcacagccacaggtgtgggcagcaggt
gagtgtacaggttttggcggaagtgagctggcgatggtcgaaggtagcatcgcaggttat
gcagctataggccaaaatgaaaaagcgagacaattatttgctcaaagacaacggtatcgt
ttatttgcacatctccttgagaaaagctttaagttacgtgctgagttaaaaacgcttgca
cgcccagaaactattttttgtcgatgtgaagatgtaacttttgataaagttgccgagcgt
aaaagttggattgatgcaaaattacatacacgctgtggaatgggggcgtgccaaggaagc
acgtgtgcaacagcagcagcttgtttatttgattggcagttgcctaactctagaccacca
ttacttcctactcgtgtaaaaagcctcatggcgatgtctacttctcctttaaatcaaaaa
tga

DBGET integrated database retrieval system