KEGG   Acinetobacter baumannii AB307-0294: ABBFA_02177
Entry
ABBFA_02177       CDS       T00795                                 

Gene name
hcnC
Definition
(GenBank) Hydrogen cyanide synthase subunit HcnC precursor
  KO
K21061  D-hydroxyproline dehydrogenase subunit beta [EC:1.5.99.-]
Organism
abb  Acinetobacter baumannii AB307-0294
Pathway
abb00330  Arginine and proline metabolism
abb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    ABBFA_02177 (hcnC)
Enzymes [BR:abb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.99  With unknown physiological acceptors
    1.5.99.-  
     ABBFA_02177 (hcnC)
SSDB
Motif
Pfam: DAO FAD_binding_2 NAD_binding_8 FAD_oxidored Pyr_redox_2 Thi4 Lycopene_cycl 3HCDH_N NAD_binding_9 FAD_binding_3 GIDA ApbA Pyr_redox HI0933_like AlaDh_PNT_C Pyr_redox_3
Other DBs
NCBI-ProteinID: ATY44612
LinkDB
Position
complement(2349900..2351003)
AA seq 367 aa
MRTDAIVIGAGIVGAACAYELARQGLNVQVLDARIGGATAAGMGHLVIMDDLEAELKLSH
WSVQLWHELGHELSEDCAYRQTPTLWLASSPEEMQIAEEKYQRLTAQGVRCQLRNADEVR
QLEPHLKQGLYGGLEVFDDGILYAPCAAEWLLKKIPHKVQVQQAKVIHIEENRVQLSDGT
WLEAAHIVLANGIHATDFFPELPIEPKKGHLAITDRYPELNVKHTLVALAYAASTQATSG
ISVACNIQPRPTGQLFIGSSRQFNTVDPTVEPEVFTRVLKEAADYFPALADLNVIRAWTG
FRAATPDGIPIIGRHPTFQSVYLAVGHEGLGVTTATGTAKLIASHICGITFDIDPEPFLP
QRFIGAA
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgagaaccgatgccatcgtcattggggcaggcattgtaggtgcggcatgtgcttatgaa
ttggctcggcaagggttaaatgtgcaagttttggatgctcggatcggtggtgccacagcc
gcgggcatggggcatttggtcattatggatgacttggaagccgaattaaaacttagtcat
tggtcagttcagctatggcatgaattaggacacgaactttcggaagactgtgcctatcgc
caaacgccaactttatggctggcaagtagcccagaagaaatgcagattgctgaggaaaaa
tatcaacgtctcactgcacaaggtgtccgttgccaacttcgaaacgcagatgaagttcgt
cagcttgaacctcacttaaagcagggtctttatggtggtttagaagtttttgatgatgga
attttatatgcaccttgtgctgctgaatggttattaaaaaaaattccccacaaggttcag
gttcaacaagctaaagttattcatattgaagaaaatcgggttcagttaagtgatggcaca
tggctagaagctgcacatatcgttttggctaacggtattcatgcgacagatttttttcca
gagctaccgattgaacctaaaaaaggtcatttggcgattactgaccgttaccctgaatta
aatgtaaaacatacattagtggctttggcttatgcggccagtactcaagcgacaagtgga
atttcggtggcttgtaatattcagcctagaccgacgggccagctttttattgggtcatct
cgtcagttcaatacggttgatccgactgtagagccagaagtctttactcgggtgcttaaa
gaggctgcggattattttccagctttggctgaccttaatgttattcgggcatggactggc
tttcgcgcagccacaccagatggtattccgataattggacgacatcctacatttcaatcg
gtttatttagcggtaggtcatgaaggattaggtgtaaccacagcaacaggtacagcaaaa
ctgattgcctcacacatatgtggaataacttttgatatagatccagaaccttttttacct
cagcgctttataggagctgcatag

DBGET integrated database retrieval system