KEGG   Acinetobacter baumannii ACICU: ACICU_00251Help
Entry
ACICU_00251       CDS       T00710                                 

Definition
(GenBank) DNA polymerase III, chi subunit
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
abc03030  DNA replication
abc03430  Mismatch repair
abc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:abc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    ACICU_00251
   03430 Mismatch repair
    ACICU_00251
   03440 Homologous recombination
    ACICU_00251
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:abc03032]
    ACICU_00251
   03400 DNA repair and recombination proteins [BR:abc03400]
    ACICU_00251
Enzymes [BR:abc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     ACICU_00251
DNA replication proteins [BR:abc03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     ACICU_00251
DNA repair and recombination proteins [BR:abc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     ACICU_00251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi TrbC_Ftype PsbY
Motif
Other DBs
NCBI-ProteinID: ACC55563
LinkDB All DBs
Position
complement(272299..272706)
Genome map
AA seq 135 aa AA seqDB search
MAKVSFYLFETSEERQVDSACRLCRKILLKHSQIWWYCPDVQLQQTLDEKLWSFDPTSFI
AHGVDQVDAAVCISAKQPSEQGWLVFNFNNHALEQVNHFSHIIEIVENNEAAKQIGREKF
KMYRRLGIEPRTFKL
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagttagcttttatctgtttgaaaccagtgaagaacggcaagtcgatagtgct
tgccgtttatgccgaaaaattttactgaagcattcacaaatctggtggtattgcccagat
gtgcagttacaacaaacacttgatgaaaaattgtggagctttgatccgaccagctttatt
gcccatggcgttgatcaggtagatgcggcagtatgtatttcggctaaacaaccttctgaa
caaggttggctggtatttaattttaacaatcatgcacttgaacaagtgaatcattttagc
cacattatagaaattgttgaaaataatgaagcagccaagcaaattggccgagaaaaattt
aaaatgtatcgtcgtttaggtatagaacctcgaacctttaaattataa

DBGET integrated database retrieval system