KEGG   Acinetobacter baumannii ACICU: ACICU_01744Help
Entry
ACICU_01744       CDS       T00710                                 

Definition
(GenBank) uncharacterized NAD(FAD)-dependent dehydrogenase
  KO
K17218  sulfide:quinone oxidoreductase [EC:1.8.5.4]
Organism
abc  Acinetobacter baumannii ACICU
Pathway
abc00920  Sulfur metabolism
Brite
KEGG Orthology (KO) [BR:abc00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    ACICU_01744
Enzymes [BR:abc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.5  With a quinone or similar compound as acceptor
    1.8.5.4  bacterial sulfide:quinone reductase
     ACICU_01744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF442 Pyr_redox_2 DAO Lycopene_cycl NAD_binding_9 Thi4 NAD_binding_8 HI0933_like FAD_binding_3 FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ACC57056
LinkDB All DBs
Position
1858110..1859765
Genome map
AA seq 551 aa AA seqDB search
MELKRVNQDFYVAGQITANDIVKIADQGIKTLICNRPDGEGADQPNVIEIEEAAQRHGLN
VIYQPVISGKISDQQVTEFKQLYQNAQKPVLAYCRSGMRAISLWALAEVAPQDAALLVES
GNKLGFNLKGLVPRILKRDHEPATIPCYSVVIVGAGAAGISVASSLLCREPHLDIVIIDP
ADTHYYQPGWTMVGGGIFKPQVTARSMTSVIPSKVKWMKAAVAGFDPEHNQVILEGCQPI
QYKALVVCPGLKLNWHGIEGLVETLGKNGVTSNYRYDLAPYTWELVQQLNSGKAIFTQPP
MPIKCAGAPQKAMYLSADYWLKQGKLKDISIHFYNTGAVLFGVKEYVPALMQYVEKYGTE
LHFNHQLVKVDGPAKKAWFKVVNDENAALVETDFDMLHVVPPQQAPDFIRASTLTDEAGW
VSVNPQTLQHTQHANIFALGDVMNAPNAKTAAAARTQAPIVAVNVIAQLKGEKNFCEYNG
YGSCPLTVERGKIVLAEFGYGGKLLPSFPKWVIDGQKPSRLAWLLKERILPPIYWQGMLK
GREWMVKPEQG
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggaacttaaacgagttaatcaagatttttatgttgctggccagattactgccaacgat
attgtaaaaattgcagaccaaggaataaaaactctgatatgtaaccgtccagatggggaa
ggtgcagatcaacccaatgtgattgaaattgaagaagcagctcagcgacatggcctaaac
gtaatctatcagcctgttatcagtggtaaaattagcgatcaacaagttaccgagtttaag
cagctttatcagaatgctcagaagcccgttttagcatattgtcgctctggtatgcgtgca
atcagtttgtgggctttggctgaagttgctccacaagatgcagcactgttagttgagtcg
ggtaataagcttgggtttaacttaaaaggcttggtgccacgtattttaaaacgtgatcat
gaaccagccacaattccttgttatagcgttgtgattgttggcgctggggcagcaggaatt
tctgtagcgtcgagtcttttatgtcgtgaacctcatttagatattgtcattattgatccc
gcagatacacattattatcaaccgggctggaccatggtcggtggtggtattttcaaacca
caagtaaccgcacgctcaatgacaagtgtgataccttcaaaagtaaaatggatgaaagct
gcggttgctggattcgaccctgagcataatcaggttattttggaaggatgccaacctatt
caatataaagcgttggtcgtctgtcctggtttaaaactcaattggcatggaattgaaggt
ttagttgaaaccttaggtaaaaatggagtgacgtctaactatcgttatgacttggcgcca
tatacatgggaactggtgcaacagttaaatagtggaaaggcaatctttacccagccgcct
atgccgattaaatgtgccggtgctcctcaaaaagcgatgtacctttcagccgactactgg
ttaaagcaaggcaaacttaaagatatctctatccatttttataacactggtgctgtttta
tttggtgtgaaggaatatgtacctgcactaatgcaatacgttgaaaaatatggcactgaa
ctgcattttaaccatcaacttgtcaaagtagatgggcctgcaaaaaaagcatggtttaag
gtagtgaacgatgaaaatgcagcattggtcgagactgatttcgatatgttgcatgttgtt
ccaccgcaacaagccccggactttattcgtgccagtacactcactgatgaagcaggctgg
gtgagtgtgaatcctcaaaccttacaacacacacaacatgccaatatttttgctttaggc
gatgtgatgaatgcacctaatgccaaaactgctgctgcggcacggacacaagctccgatc
gttgctgtgaatgttatagcccagctcaaaggtgagaaaaacttctgcgagtacaacggc
tatggctcatgtccacttacggtagaacgaggaaaaatcgttctggctgagtttggctac
ggcggcaaattacttccaagttttccaaaatgggtaattgatgggcaaaaaccttcccgt
ttggcttggctgcttaaagagcggattttaccgccgatttattggcaaggcatgctcaag
ggccgcgagtggatggtcaaacctgagcaaggataa

DBGET integrated database retrieval system