KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_0264Help
Entry
ABTW07_0264       CDS       T01908                                 

Gene name
tetA
Definition
(GenBank) tetracycline resistance protein, class G (TETA(G))
  KO
K08151  MFS transporter, DHA1 family, tetracycline resistance protein
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Brite
KEGG Orthology (KO) [BR:abd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:abd02000]
    ABTW07_0264 (tetA)
   01504 Antimicrobial resistance genes [BR:abd01504]
    ABTW07_0264 (tetA)
Transporters [BR:abd02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    ABTW07_0264 (tetA)
Antimicrobial resistance genes [BR:abd01504]
 Gene variants
  Tetracycline resistance genes
   Transporters
    ABTW07_0264 (tetA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_1_like Nuc_H_symport BT1
Motif
Other DBs
NCBI-ProteinID: ADX90701
LinkDB All DBs
Position
complement(287677..288870)
Genome map
AA seq 397 aa AA seqDB search
MVITLLDAMGIGLIMPVLPTLLREFIASEDIANHFGVLLALYALMQVIFAPWLGKMSDRF
GRRPVLLLSLIGASLDYLLLAFSSALWMLYLGRLLSGITGATGAVAASVIADTTSASQRV
KWFGWLGASFGLGLIAGPIIGGFAGEISPHSPFFIAALLNIVTFLVVMFWFRETKNTRDN
TDTEVGVETQSNSVYITLFKTMPILLIIYFSAQLIGQIPATVWVLFTENRFGWNSMMVGF
SLAGLGLLHSVFQAFVAGRIATKWGEKTAVLLGFIADSSAFAFLAFISEGWLVFPVLILL
AGGGIALPALQGVMSIQTKSHQQGALQGLLVSLTNATGVIGPLLFAVIYNHSLPIWDGWI
WIIGLAFYCIIILLSMTFMLTPQAQGSKQETSCQFHK
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
ttggtaattacgttactcgatgccatggggattggccttatcatgccagtcttgccaacg
ttattacgtgaatttattgcttcggaagatatcgctaaccactttggcgtattgcttgca
ctttatgcgttaatgcaggttatctttgctccttggcttggaaaaatgtctgaccgattt
ggtcggcgcccagtgctgttgttgtcattaataggcgcatcgctggattacttattgctg
gctttttcaagtgcgctttggatgctgtatttaggccgtttgctttcagggatcacagga
gctactggggctgtcgcggcatcggtcattgccgataccacctcagcttctcaacgcgtg
aagtggttcggttggttaggggcaagttttgggcttggtttaatagcggggcctattatt
ggtggttttgcaggagagatttcaccgcatagtcccttttttatcgctgcgttgctaaat
attgtcactttccttgtggttatgttttggttccgtgaaaccaaaaatacacgtgataat
acagataccgaagtaggggttgagacgcaatcgaattcggtatacatcactttatttaaa
acgatgcccattttgttgattatttatttttcagcgcaattgataggccaaattcccgca
acggtgtgggtgctatttaccgaaaatcgttttggatggaatagcatgatggttggcttt
tcattagcgggtcttggtcttttacactcagtattccaagcctttgtggcaggaagaata
gccactaaatggggcgaaaaaacggcagtactgctcggatttattgcagatagtagtgca
tttgcctttttagcgtttatatctgaaggttggttagttttccctgttttaattttattg
gctggtggtgggatcgctttacctgcattacagggagtgatgtctatccaaacaaagagt
catcagcaaggtgctttacagggattattggtgagccttaccaatgcaaccggtgttatt
ggcccattactgtttgctgttatttataatcattcactaccaatttgggatggctggatt
tggattattggtttagcgttttactgtattattatcctgctatcgatgaccttcatgtta
acccctcaagctcaggggagtaaacaggagacaagttgtcagttccacaaataa

DBGET integrated database retrieval system