KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_1961Help
Entry
ABTW07_1961       CDS       T01908                                 

Definition
(GenBank) AraC-type DNA-binding domain-containing protein
  KO
K07506  AraC family transcriptional regulator
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Brite
KEGG Orthology (KO) [BR:abd00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:abd03000]
    ABTW07_1961
Transcription factors [BR:abd03000]
 Prokaryotic Type
  Helix-turn-helix
   AraC family
    ABTW07_1961
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_AraC HTH_18 DUF4160
Motif
Other DBs
NCBI-ProteinID: ADX92390
LinkDB All DBs
Position
2081126..2081980
Genome map
AA seq 284 aa AA seqDB search
MAYQTLEQLQQSKAKLHETVVLDENMQLAFWSNQQDRVSVCSDHHTLSLYIQDGYESYQK
TPAGWKNGGGPGRFCLLPEHQESTWDIRGGLKFVHLYYTDQHLRDVAEKIWDKEPNQIEL
NEVVFNDDERIRALYQFFLLDCDWQDSSNHLQMSTTASLLLNHLIRKYSSVQWQQPTIKG
GLAPHKLKYIQEWIEDHLDQALTLSDLANIVNLSEYHFAHMFKQSMNMAPHQYVMQRRLT
KAKGLIQSSQLSLQDIALVCGFSSASHLSHRFKQFYGMSPSQLR
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggcttatcaaactttagaacagctgcagcagtctaaagccaagcttcacgaaactgtg
gtgcttgatgaaaatatgcaacttgcattttggtctaatcagcaagatcgtgtaagtgtc
tgtagcgatcaccacactctaagtctttatattcaagatggttatgaaagctatcaaaaa
acacctgcgggctggaaaaatggtggtgggccgggacgtttttgcctattgcccgaacat
caggagtcaacttgggacatacgtggtgggcttaaatttgtccacttgtactacactgac
caacatttgcgtgatgttgctgaaaaaatatgggacaaagagccgaatcaaattgaacta
aacgaagttgtatttaatgatgatgaacggattcgggcgttatatcaattcttcttgtta
gattgcgattggcaagattcttcaaatcatttgcaaatgagtacaacggcaagtttattg
ttgaatcacttaattcgaaaatatagtagtgttcaatggcaacagcctactatcaagggc
ggactggcaccccataaactcaaatatattcaggaatggattgaagatcatctagatcag
gcactcactttgtctgatttggcaaatattgtgaatttaagcgaataccattttgctcat
atgtttaaacagtccatgaatatggcgcctcaccaatatgtcatgcaaagacgcttaact
aaggccaaagggctaattcagtcatctcagctttctttgcaagatattgccctagtatgt
gggtttagttcagcaagtcatttaagtcatcgctttaaacaattttatggcatgagtcct
tcgcagttacgttaa

DBGET integrated database retrieval system