KEGG   Acinetobacter baumannii TCDC-AB0715: ABTW07_2888Help
Entry
ABTW07_2888       CDS       T01908                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
abd  Acinetobacter baumannii TCDC-AB0715
Pathway
abd00550  Peptidoglycan biosynthesis
abd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abd00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ABTW07_2888
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:abd01002]
    ABTW07_2888
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:abd01011]
    ABTW07_2888
Enzymes [BR:abd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ABTW07_2888
Peptidases [BR:abd01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   ABTW07_2888
Peptidoglycan biosynthesis and degradation proteins [BR:abd01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   ABTW07_2888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: ADX93311
LinkDB All DBs
Position
3074322..3075470
Genome map
AA seq 382 aa AA seqDB search
MTRKSAIAALLLLPSFSYAATVLSAPPELNNKSYVLMDYETGQILASKNENEKLAPASMT
KMMTSYIIEQKLLKGELTENEQVRMNESAWCKGSSSESCMYVPLNGTATVLEMLRGIIIQ
SGNDASKAMAEHIAGNEGTFAHMMNQEAKRIGMTNTQFINSTGMPAEGHYSTAKDMAVLA
QHIIKDSSKYYPIYSEKEFTFNGIKQGNRNALLYTDPSVDGLKTGHTDEAGYCLTTSSKR
GPMRLISVIFGTPSMSERADQTRALLAWGFANFETANVQPANQVLAKAKVWFGKENEVQV
GLAENFNVTMPKGKADGIKTQLVVQPNLSAPLQKGQVVGKLVASLDGKVIAEKPLVALKP
VEEAGFFARLIDHIKQFFSNLF
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgactcgaaaaagcgctattgctgcactcctcctcttaccaagtttttcttatgcagca
actgtcttatcagctccgccagaattaaataataagtcttatgtattaatggattacgag
acaggacaaattctcgcttctaaaaatgaaaatgaaaagcttgctcctgcttctatgact
aaaatgatgacaagctacatcattgaacaaaaattattaaaaggtgagcttaccgaaaat
gaacaggttcgtatgaatgaatctgcttggtgtaaaggcagtagttctgaatcatgtatg
tatgttccattaaatggcacagcaactgttttagaaatgcttcgcggtattattatccag
tcaggtaatgatgcatcaaaagcaatggctgaacatattgctgggaatgaaggtactttt
gctcacatgatgaaccaggaagcaaaacgtatcggaatgaccaatacccagtttattaac
tcaactggtatgccagctgaaggtcattactcaactgcaaaagatatggctgttttagca
caacatattattaaagacagctcaaaatactacccgatttattctgaaaaagaattcaca
tttaacggtatcaaacaaggtaaccgtaatgctttactttacactgacccaagtgttgat
ggcttaaaaacaggccatactgatgaagctggttactgcttaacaacttcaagtaaacgc
ggtccaatgcgtttaatctcagttattttcggtacaccaagcatgtctgaacgtgctgac
caaactcgtgcattattggcatggggttttgcaaactttgaaactgcaaatgtacaacct
gcaaaccaagtgcttgcaaaagctaaagtttggtttggtaaagaaaatgaagttcaggtt
ggtttagctgaaaactttaatgtgactatgcctaaaggcaaagcggacggcattaaaact
cagttggttgttcaaccgaacctaagtgcaccacttcaaaaaggtcaagtcgttggtaag
cttgttgctagtttagatggtaaagttattgctgaaaaaccattggttgctttaaaacct
gttgaagaagctggtttcttcgcacgtttaattgaccatatcaaacaattcttcagcaac
ttattctaa

DBGET integrated database retrieval system