KEGG   Trichophyton benhamiae: ARB_00389Help
Entry
ARB_00389         CDS       T01611                                 

Definition
(RefSeq) hypothetical protein
Organism
abe  Trichophyton benhamiae
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_3 Glutaredoxin GST_C_5
Motif
Other DBs
NCBI-GeneID: 9526794
NCBI-ProteinID: XP_003013205
UniProt: D4AW25
LinkDB All DBs
AA seq 645 aa AA seqDB search
MADTGPSKLPGPHDLRDQHATAPPTDPELESQLHSLNAVQSLASPVVDSIQQHQQHQQQQ
QQQQTSGRGISSRGAFDADLNNAAEGHLPPAVRSAGHGLEQIEQMDQVDITFSGDGMVLS
TPHDARLSQHPDDVAGHQFVSPTNNDMQFSPFTQQHLPQNMIPHFQSPGQADMSQGGSSH
ASEGHFKNMKCIPNPPDLQKWREKLFNVEDTIVLSEEEFQTYFPHVDNVYSHRSTQRYKR
KPFISHYWDCRLKGRPPGTPKTHDPNKKKRKRTARERNLCDVKIKITEYFPGAINSSQDI
PSGFEQPSQASSPSDLLVVPGSSNSNLDGSQPFGVLTPSATLPPGHPGVAGARYYTIQRV
NGNGGNGRSDSVEGPHRHTLEESDRIKKNSVQRNLLKEEKDKKKSTTQQKSYHSRASGYA
YSTVKKHAKESDLKLYGSCFCPFVQRVWIALEVKGIPYQYIEIDPYKQPDSLLEVNPRGL
VPAIRHGNWGCYESSVLLEYLEDLDIGKPLLPPGDPQLRAHCRLWADHINRHIIPCFYRL
LQEQDPGKQITITEQLKDHISKLVNASHVHGPFFLGRSISFVDIHFAPWMLRLTRVLKPY
RAWPDPERGSRWAAWMEAVELDEHVMATTSADDLYLDSYQRYAGE
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaccgggccgagcaagctgcctggcccccacgacctgcgcgaccagcacgcg
acagcaccgcccaccgatccagagctcgagtcacagcttcacagtctcaatgccgtccag
tcgctcgcctcgcccgttgtcgactcgatacagcagcatcagcaacatcagcaacagcaa
caacaacaacaaacgtccggaagaggcatatcgtcacgaggggcgttcgacgcggacttg
aacaatgcagcagaaggacacctcccgccagcagtacgatctgccggtcatggcctggag
cagatcgagcagatggaccaggtggacatcacattctctggtgacgggatggtgttgagc
actccgcatgatgccagactctcacagcacccggacgacgttgctggccatcaatttgta
tcgccgacgaacaatgacatgcagttctcaccgtttacccagcaacacctgccacagaac
atgataccccatttccagtccccgggtcaggcagacatgtctcaggggggcagcagtcac
gccagcgaaggccatttcaagaatatgaaatgcatacctaacccgccggacctccagaaa
tggagagagaagctgttcaacgtggaagacacgattgtcttgagcgaagaggagttccaa
acatatttcccccatgtagataacgtctactcccaccggtccacccagagatacaagcgc
aagccctttatatcccattactgggactgtcggctaaaaggacgcccaccaggaacccca
aagacccatgaccccaataagaagaagcgaaagagaaccgctcgagagcgtaatctatgc
gacgtcaagataaagatcacggaatacttccctggcgccataaatagttcccaagatatt
ccctcgggattcgaacaaccttcccaggcttcttcaccttctgatctcctggtagtacct
ggctcatcaaactcaaatctagacgggtctcagccgttcggcgtactaacacccagtgca
accttgccaccaggccatcctggcgtggccggggctcgatattacacaattcaacgtgta
aatgggaatggggggaatggaagatcagactccgtcgaaggcccacaccggcatacactt
gaagaaagtgaccggatcaagaagaatagtgtgcagaggaatctactaaaggaggagaag
gacaagaagaagtcaactactcagcaaaaatcataccatagccgtgcatctggatatgca
tactccactgtgaagaaacatgcaaaggagagcgacttgaaactttatggcagctgtttc
tgcccctttgtacagagggtatggattgcccttgaggtcaagggaataccatatcagtac
attgaaatcgacccatacaagcaaccagactctctacttgaagtaaaccctcgcggcctg
gtgccagccattcgacatggcaactggggatgctatgaaagtagtgttcttcttgaatat
ctcgaggatttagatattggcaaacccttgttacccccaggagatccgcagcttcgtgca
cattgccgtttatgggcagaccatataaaccgccatataataccctgtttttaccggctg
ctgcaagaacaagacccagggaagcaaattacgatcactgaacaactaaaggaccatata
agcaagcttgtcaacgcctcgcatgtccatgggccgttcttcctaggccgcagcatctcg
ttcgttgacatccattttgctccatggatgctaaggcttacccgggtattgaaaccttac
cgtgcgtggcctgatccagaaaggggcagcagatgggctgcgtggatggaagcagtggag
ttagatgaacatgttatggccactacgagcgccgatgatttatacttggatagctaccag
agatatgcaggtgagtag

DBGET integrated database retrieval system