KEGG   Trichophyton benhamiae: ARB_01787Help
Entry
ARB_01787         CDS       T01611                                 

Definition
(RefSeq) hypothetical protein
Organism
abe  Trichophyton benhamiae
SSDB OrthologParalogGFIT
Motif
Pfam: DUF917 Pyridoxal_deC Hydantoinase_A Hydant_A_N MutL BcrAD_BadFG BRE Aminotran_5
Motif
Other DBs
NCBI-GeneID: 9519518
NCBI-ProteinID: XP_003012031
UniProt: D4B016
LinkDB All DBs
AA seq 1549 aa AA seqDB search
MSSLAAPYRIGVDVGGTNTDSVILDVRATNEVNRGVIAQHKTPTTSPNVTDGIESAVLNV
LEQSKVPRDQIACLTIGTTHFINAIVEHDARRLSKVAIIRLSKSFTREVPPFSDFPPVLK
SIMNGYYTYVDGGLTIDGAAESPINETQVVKECAKIKELGLDAVVISGVFSPIDKHFFQE
DNVRKIIQRELPGVDIVCSSEVSQIGFLERENASILNASILRFARRTIRGFKSAMKRLSL
NCPLYLTQNDGTLIDAPSASRLPIRTFSSGPTNSMRGAAYLGLSGPDDTGNDRTATIVVD
IGGTTTDVGVLLPSGFPRQASAYVEVAGVKINFGMPHVESIGLGGGSIVRHKGANTTIGP
DSVGHYLSTKGTVFGGDTLTATDIAVAAGAKIGNPDLVKDLDKELVSAAQARVKTMLETV
IDQMKTSPAPLPVLLVGGGSILAPAELDGVSKVIFPPFHSVANAVGAAMSKVGGTVDSIE
STAEKTVAEVVDEAKARAIEKAVASGAIRETVYLAEVDSMPLQYVANQVRVIARAVGELS
PEGVLTLDNIRNDGDDDEGDDTIYNEVPKQNLETEEFNANTIDVATYRPKVVQNPQTGID
EWIVSETDVAWLADGCYVLGCAGGGSPFSEHIRIRDQIRQGHIIRIIDPYSVKKDAVIYL
LMPVEGGGHMGSPAVSVERQANNETEQSIHALMEYLNHGSFDAVMGVEIGGGNGILPLSI
GSSKHFDRPVVDADWMGMYQSSFPFDISDIYCFLRLAARPTTGDKMLRFGVLNTMSLAWR
IGRCIARANATNTISTVAEQMIDEVGGPESGKILFRGKIVAVERRLFKGHSYGEITIQQV
LNKEVESSIADELSGDARRSSTPVATGGVLKIPFKNENIYAKHISDEGVEKYVATVPDLI
CVLDTQSGKALGVPEFRYGVMVTVLGIACSPRWSDTERALEIGGPGAFGYKDIKYVPLGK
YVEPKSVVTEYAERLDIYSTEKEEKAKITPRTYVDPDDIIKHFREDFDKEQEREASAIFT
SNAVSSVTPYSTRYSSKEEIPKFKIPKLGARADAVHHMLSNELDLDGIPNLNMASFVGTY
MDREANQLVVENISKNLADADEYPALMAIHARCISMISNLWNPRPGEEATGSATTGSSEA
IMLGGLAMKKNWQQKRKDEGKDISNPNIIMGSNAQVALLKFARYFDVEARVLDVSEKSQF
RLDPDLVKKNVDENTIGIFVILGSTYTGHYEPVEEISNILDSIQSETGIDVPIHVDAASG
GFVAPFTDAGAGGPKWNFELPRVKSINASGHKYGLVYAGLGWIIWRDRSYLPKELIFELD
YLGSREETYTLNFSRPGAQVIGQYYNFIRLGFNGYREIMENCLANARLLSKTLERTGWFV
CLSDIHRKKGEFYHQHLDKITPYKEDETSADYNAGLPVVTFRFSDAFKENYPHVKQESIS
LLLRSKQYIIPNYPLPPKEQDTEILRVVVRESMAADLIDKLVADIAAVTERLMKSDPVDL
SALQTGPTNLERRRVRNREHPHKVTKRPSGKKEKTAGHPMRSGIHRSVC
NT seq 4650 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcattagcagctccttatcggatcggtgtcgacgtcggcggcaccaacacggac
agcgtcatattggatgttcgtgccacgaatgaagtaaatcgcggggtgattgctcagcat
aaaaccccaactacaagtcccaatgttaccgatgggatagaaagtgccgttctcaatgtc
cttgagcagtccaaggtaccgagagatcaaattgcctgcctaaccattgggacaacgcat
tttatcaacgccatagtggaacacgatgctcgacgcctatcaaaagtggccatcatccgg
ctttccaagagtttcacgagagaggtaccccctttttcagacttcccaccagttctcaag
tcaattatgaacggctactacacctacgttgacggtgggctcactattgatggagcagca
gaatcacctataaatgaaactcaggtggtcaaagaatgtgccaaaattaaagagttaggg
ttagacgcagtcgtcatctctggtgtattctctccaatcgacaagcattttttccaagaa
gacaatgttcgaaagatcattcaaagagagctacctggagttgatattgtttgctcttct
gaagtctcccagattggattccttgagcgtgagaatgcatctattctcaatgcctctatc
ctcaggtttgcacggcgcaccatccgaggctttaagtcagcaatgaaacgcttaagcctg
aactgtcctctataccttactcagaacgacggaactttgattgacgctccttctgcttca
agacttccaatccgtactttttcctctggaccaaccaattctatgagaggagctgcatat
ttaggacttagcgggccagatgataccggaaatgaccgtacggcaacgattgtcgttgat
attggtggtactaccacggacgttggagtattactcccgtctggattcccgcgtcaggct
tctgcgtatgtcgaagtagctggcgtgaagatcaatttcggcatgccccatgtcgaatcc
attggtctcgggggtggttccatagtccgtcacaaaggagccaacactaccattggaccg
gattctgtcggccattatctcagcaccaaaggcactgtattcggaggagacacacttaca
gcaacagatattgctgtggctgctggagccaagattggcaaccccgacttggtcaaggat
ttggacaaggagctggtttccgctgcgcaggcaagagtgaaaactatgctggaaacagtt
attgaccaaatgaaaacttcaccagcccctttacctgtactgctagtcggaggcggctca
attttggctccagcggaactcgatggcgtgtcaaaggtcatttttcccccatttcattcc
gttgcaaacgcagtcggtgctgccatgtctaaggttggcggcacagttgactctattgag
agtacggctgaaaagactgtagccgaagttgttgatgaagccaaagccagggcgattgaa
aaagcggttgcctctggtgccatcagagagacagtatacctggccgaggttgattcgatg
cctcttcaatacgtcgcaaaccaagtgcgcgttattgcgcgtgctgttggtgagctgtcg
cctgaaggtgtcctaactctcgacaacatacgaaatgatggagatgatgacgaaggagat
gatacaatatataacgaggttcctaagcagaatcttgagaccgaagagttcaacgccaac
acaatagatgttgcaacctaccgcccgaaagtcgtgcaaaaccctcaaacagggattgac
gaatggattgtttccgaaacagatgttgcctggcttgctgatgggtgctacgtcctggga
tgtgctggtggaggctcgcctttcagtgaacacatccgaattcgcgatcagatacggcaa
ggacacattatacgtatcattgacccatattccgtaaaaaaggatgctgtgatatattta
ctgatgccagtggaagggggcggtcacatgggttctccagctgtctctgtagaacgacaa
gcaaacaacgagaccgaacaatccatccatgcccttatggagtatctcaatcatggcagc
tttgacgctgtaatgggagtagaaatcggtggcggcaatggtatcctgcctctttctatc
ggctcgtcaaagcattttgatcgccctgtagtcgatgctgattggatgggtatgtatcaa
tcttcctttccatttgatatttctgatatttattgttttttgcgcttggccgcccgtcct
actacaggcgacaaaatgttaaggttcggtgtactcaataccatgtcccttgcgtggcgt
attgggcgttgcatcgcgcgtgcaaatgctaccaacaccattagcaccgtggctgaacag
atgattgacgaggttggcggtcctgaatctggtaagattctcttcagaggaaagatagtt
gccgtggaaagacgactattcaagggccattcttatggcgaaatcacaattcaacaagtc
cttaacaaagaagtcgagtcaagtatagcagacgagctctcaggagatgcaaggcgatca
tcgacacctgtggccaccgggggtgtcctaaagatccctttcaagaacgaaaatatctat
gccaaacacatttccgacgaaggcgtcgagaaatatgtggcaacagtgcctgatctgatc
tgcgtccttgacacacagtctggaaaggcgcttggggtccccgaattcagatatggtgtt
atggtaactgtgttgggaattgcatgttccccacgatggtcagataccgaaagagcactg
gagattggcgggccaggggcgtttggatataaggatatcaaatacgttcccttgggtaaa
tacgtagagcccaaaagtgttgtgacggaatacgcagagcgactagatatatattcgact
gagaaggaggaaaaggccaaaataacaccgaggacttatgttgatcctgatgatatcatc
aaacactttcgagaagatttcgacaaagaacaggagcgggaagcttctgccatctttacc
tcaaatgccgtctcgtctgtaacgccgtattcaacgagatattccagcaaagaggagata
cctaaattcaaaatccctaagctaggtgctcgcgcagatgcggtgcatcatatgctgagc
aatgaactcgatctagatggtatcccgaatctgaacatggcaagtttcgttggtacttac
atggaccgagaagcaaaccaacttgtagttgagaatatcagtaagaatctagcggatgca
gatgagtatcctgcgttaatggctatacacgcaagatgtatatccatgatatccaatcta
tggaacccacgaccaggagaagaagccaccggatctgcgacaactgggtcctctgaagct
atcatgttgggtgggctggccatgaaaaagaactggcagcagaaacgtaaggatgaagga
aaggacatctctaatccaaatatcatcatgggatcaaatgctcaggtagctctcctgaaa
ttcgccaggtactttgacgttgaagctcgagttctggatgtatccgagaagagccaattt
cgtctcgacccagatttggttaagaaaaatgtggacgagaataccattgggatatttgtg
atccttggaagcacctatactggccactatgaacctgtcgaagagatctctaatatcctg
gatagcatacagtccgaaaccggtatagatgtccccattcatgttgatgctgccagcggt
ggatttgtggcaccattcactgacgcaggggctggagggccaaaatggaatttcgaactt
cctcgagtgaagtcaatcaatgcatccggacataagtacggtctcgtgtatgcaggattg
ggttggataatctggcgagaccgctcctatctgccaaaagagctcatcttcgagcttgat
tatctcgggagcagagaggagacttatacattgaacttctccaggcctggagcacaggta
attggccagtattataacttcatccgccttgggttcaatgggtatcgagaaatcatggaa
aactgtttggcaaatgcaagactgctgagcaaaactttggaacggactggatggtttgtc
tgtttgagcgatatccaccggaagaaaggggaattctaccaccagcatctggacaaaatt
acgccctataaggaggacgaaacgtctgctgactataacgctggtttgccagtggtaaca
ttccgattctcagatgcattcaaagagaattatccccatgtgaagcaagagagtataagc
ctcctgctgaggtcgaagcagtatataattcccaactaccctttacctcccaaagagcag
gacacggagattctgcgggtggttgtccgggagagcatggccgcagacctcatcgacaag
cttgtggcagatattgctgcagtcaccgagaggctgatgaaatccgaccctgtcgacctg
tctgcactccagacaggcccaaccaatcttgagcggcgtcgagtgagaaacagagagcat
cctcacaaggtcacaaagcggccaagcggaaagaaagaaaagactgcaggccatccgatg
agaagtggaatccaccgctctgtttgttag

DBGET integrated database retrieval system