KEGG   Trichophyton benhamiae: ARB_02101Help
Entry
ARB_02101         CDS       T01611                                 

Definition
(RefSeq) alpha-glucosidase AgdA, putative
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
abe  Trichophyton benhamiae
Pathway
abe00052  Galactose metabolism
abe00500  Starch and sucrose metabolism
abe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ARB_02101
   00500 Starch and sucrose metabolism
    ARB_02101
Enzymes [BR:abe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     ARB_02101
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 9523318
NCBI-ProteinID: XP_003011548
UniProt: D4B0X3
LinkDB All DBs
AA seq 865 aa AA seqDB search
MFGRTLALAAVFATTVLSAAASLEECPGYKVSNVRDNGHTLKADLRLAGKACNVYGEDIR
QLKLRVEYQTHERLHVIIEDSKEDVYQVPESVFPRPESEENDSASTKSALKFSMTQKPFS
FKVTRRATDEVIFDTSNSPLIFESQYLRLRTSLPDEPNLYGLGEHSDPLRLQTEDLVTTL
WNRDAFGIPPGTNLYGSHPVYYDHRGRSGTHGVFLLNSNGMDVKVGSEDGDNGKKYLEYN
ILGGVLDFYFMAGPTPKEVASQYAEVVGLPAMMPYWGFGLHQCRYGYRDAFNVAEVVYNY
SQAGIPLETMWTDIDYMDGRKVFTLDSKRFPIDEMRALVEYLHDRNQHYIVMVDPAVSYG
DNDAFERGKTQDVFMKSKDGAIYKGAVWPGVTAFPDWFHPGTQDYWNNEFKLFFDPEKGI
DIDALWIDMNEASNFCDWPCSDPEGWERDHDLPPAPPPVRPIPRPLPGFPDKLQPGSVRL
VKRDGTRLRSKAGLPGRDLIDPPYRIQNEAGSISNKTLNTDLVHANGLVEYDTHNLYGTM
LTKYRLGDNLSEWSQYRFSISQILQFAAIYQVPMVGADVCGFGGNVTEELCARWAMLGAF
YPFYRNHNDIAGRDQEFYRWESVTEAARTAIGIRYKLLDYIYTAFHRQTQSGDPVLNPLF
YIYPEDEDTFAIDLQFFYGDALLVSPVTEEGATSVEIYLPDDIFYDYYTGEPIEGKGDLI
TMENVPITHIPLHFRGGQIVPMRADSANTTTELRKQPFELVICLDREGNAEGSLYLDDGD
SLEQPHTSEINFEYHNGVLKVSGKFDFQNEEALEIKNIFVLGYKQDMNVQDKGNMNKDSQ
YDARLKKLAIKAKILLTGPSEMTLH
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atgttcgggcgcacactcgccctcgctgcagtcttcgctacgactgttttgtcggctgct
gcgtccctggaggagtgcccggggtacaaggtatcaaacgtcagggacaatggccatact
ctgaaagcggacctccggctcgcaggcaaagcatgcaatgtttacggcgaggatatcagg
cagttgaagctccgtgttgaataccagactcatgaacggttgcatgttatcattgaggac
tctaaagaagacgtatatcaggtccctgagtctgtgtttcctcgaccagagtctgaagag
aatgacagtgcttcgacaaaatcagctttaaaattctccatgacccagaagccattctcc
ttcaaagtaaccaggcgagctactgatgaagtcatctttgatacatccaactctcctttg
atctttgaatctcagtatctacgccttcgcacttctctgccggatgagcccaacttgtac
ggactaggagagcacagtgaccctttacgcctacagacagaagatcttgttactacactt
tggaatagagatgcctttggtattcctcctggcactaacttgtacggttcacacccggtc
tattatgaccatcgagggagatcaggcactcatggtgtctttctcttgaactccaatggc
atggatgtcaaggtagggagtgaggatggtgacaacggaaaaaagtacctggaatataat
atcctaggaggcgtcttagacttttatttcatggctggaccgacgccaaaggaggttgct
tctcaatatgctgaagtggttggcctgcccgccatgatgccctactggggttttggactt
catcaatgccggtatggctaccgggacgcttttaatgttgccgaggtggtctacaactat
agccaggctggtatccccttggaaactatgtggacggatatcgactacatggacggacgc
aaagtcttcacactggactcgaagcgcttccccatagacgagatgagagccctagtagag
tacctccacgatcgcaaccagcattacattgtcatggtagatccagcagtgagctacggc
gacaatgacgcctttgagagagggaaaacgcaagacgtgttcatgaaatccaaggacgga
gcaatctataaaggcgccgtctggcctggtgtcactgcatttcctgattggtttcatccc
gggactcaagattactggaataatgagttcaaattgtttttcgaccctgaaaaaggaata
gacatcgatgctctctggatagatatgaacgaggcttctaatttttgcgattggccgtgt
tctgaccctgaagggtgggaaagagaccatgatctaccaccagctcctccaccagtcaga
ccgatcccaagaccgctacctggatttccggataaactccagcctggtagcgttaggctt
gtcaagcgtgatggaacaagattaagaagcaaagctggcttgccaggtcgtgatcttatt
gatccgccatacaggatccagaacgaagctggatctatcagcaacaagaccttgaatact
gacctggttcatgccaatggtctagttgagtatgatactcataacctttacggcactatg
ctaactaaatacaggctcggtgataatctcagtgaatggagccagtaccggttttcaatt
tcccagatccttcaatttgcagctatataccaggttcccatggtaggagctgacgtatgc
ggctttggtggtaacgtcacggaagaattatgtgctagatgggctatgctaggtgccttt
tacccgttttataggaatcacaacgatattgctggccgagaccaggaattttaccgctgg
gagtccgtaaccgaggcagcaaggactgccattggaatcagatataaactccttgactac
atctacactgctttccaccgtcaaacacagtctggagaccccgttttgaacccactcttc
tacatctacccagaggatgaagatacctttgcaatcgacctacagttcttctacggcgat
gctttgttggttagtccggtaacggaagaaggtgccactagtgttgaaatatatctgcct
gatgatatcttctatgattactatacaggggaacctattgaaggaaagggagacctgata
acaatggagaatgtccccatcacgcacattccccttcacttccgcggcggacaaattgtc
ccaatgcgcgccgacagtgccaatacaaccaccgagctgcgaaaacagccattcgaactt
gtcatctgcctcgaccgtgagggtaacgcagaaggtagcctctatctagatgatggtgat
tcccttgagcaaccccatacatcagaaatcaactttgaataccacaacggagtcctcaaa
gtctctggaaagttcgatttccaaaacgaggaagctttagagatcaaaaacatatttgtc
ctgggttacaagcaggatatgaatgttcaagacaaagggaatatgaacaaagactcccaa
tatgatgcgagattgaaaaagctggctatcaaagctaaaattttacttacggggccttct
gaaatgactcttcactag

DBGET integrated database retrieval system