KEGG   Trichophyton benhamiae: ARB_02327Help
Entry
ARB_02327         CDS       T01611                                 

Definition
(RefSeq) zinc-binding oxidoreductase, putative
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
abe  Trichophyton benhamiae
Pathway
abe00500  Starch and sucrose metabolism
abe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ARB_02327
Enzymes [BR:abe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     ARB_02327
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 ADH_zinc_N_2 CBM_20 ADH_zinc_N
Motif
Other DBs
NCBI-GeneID: 9523245
NCBI-ProteinID: XP_003011477
UniProt: P0DN30
LinkDB All DBs
AA seq 1028 aa AA seqDB search
MRVTSLLWSSLVIPAAVGFQVRFKPSEDTALDTVDDGTLQSLLDNIGLNGSNAWDTRPGL
VIASPSKKDPNYFFTWTRDSALVLKCITDAFAAGNTALQETIHEYISSQARIQLLNTRSG
GLSSGGLGEPKYRVDETPYNEDWGRPQADGPALRATALIAYARWLLENDYYDVAKSIVWP
VVKNDLSYVSEHWNTTAFDLWEEVNSPSFFTTIVQHRALVEGINIARALDETCPHCESQA
PQALCYLQSYWTGTAVRSNYGQGRSGLDVASILGSIHTFDPEGECDDTTFQPCSARALAN
HKAVTDSFRSIYKINGGIKQGEAVAVGRYPEDVYFNGNPWYLATYAAAEQLYDAMYQWNK
IGKITVTDVSMPFFKDIYPEVQTGTHESSSPEFGNIIAAVKAYAEGYIEVAKKYTPCTGM
LSEQFSRDNGTPLSVADLTWSYASYLTVMARRNSVVPASWGEKNARDIPSTCVPSSATGP
YQTATITHWPPNLTPTAQPSPCPTALPTKNNVRFRLLATTQVGEDVFLVGSIPELGSWDV
KKAVPLNADIYADNCHQWYVDIELPTAVAFEYKFIRKRGGEVIAFYQINILFYTSSLNPD
IPIYSQKLANTTTHAQSLELVFPHPLSETTGAARRADSDYKKAFLPPLSSPPIFHCSVSS
VNSSPHRFSSTLLRQNRQPALIPYEEKPEKKYQYTQDMASVTSVPKTGRSVNQDVPATTL
TLQTRPTPAPNFDEGEHLIRVHATALCAGELYWHTYVTFTKEETVPGPDVAGTVVLAPPS
SPFKPGDDVYCRIPYSRAGGARDHTIALTSELARKPKNLTWEEAATVPLSALTAWQALFD
QSGLWEGPEDERVKGKRVAVTAASGAVGMWILQFARIAGFDAVIGTCGDGNEDFVKSMGA
TDAVNYKTTSLTAWAAEKQGRKADLVIDCFGGKSLADAWGCVKDGGVLISMVGYPEQEKP
AGLEVKDVKSHFFIMEPRGDQLQKVTELVEQGKCSFLMDSVYPLEQFQEATDKVESRRVR
GKVVLKVL
NT seq 3087 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtaaccagtctgctatggtcttccctggttataccggctgctgtgggctttcag
gttcggtttaagccatccgaggatactgctctcgacaccgtggacgatggtacactgcag
agcttgctcgataacatcgggttgaacggctcgaatgcctgggatacgaggccggggttg
gttatagctagtcctagcaaaaaggatccaaactatttctttacctggacgagagactcg
gctctagtgcttaagtgcattaccgacgcctttgcagctggaaataccgctctacaggag
acaatccacgaatacatctcatctcaagctcgcatccagttgttaaacactcgctctggt
ggtttgtcaagcggagggctcggagaaccgaaatatcgagtggacgaaaccccgtataat
gaggactggggccgacctcaggctgatggacctgcgctaagagctactgccttgattgca
tacgcaagatggcttcttgaaaatgactactatgatgtagctaaatcgattgtttggccg
gttgtcaaaaatgacctttcatatgttagcgaacactggaacactacggcctttgatcta
tgggaggaagtaaatagtccatcctttttcaccactatcgtccaacaccgggctttggtg
gaaggtataaacatagcgcgtgcattggacgaaacctgccctcattgcgaatctcaggca
ccccaagcactctgctacttgcaatcgtactggactggaaccgccgtccggtcgaactat
ggtcaaggtcgctccgggcttgatgtagcctctattctaggctctatccacacatttgac
cccgaaggagaatgtgacgacaccaccttccaaccttgctctgcgcgagcactagcaaac
cacaaggcagtcacagattccttccggtccatctataagattaacggtggtatcaagcag
ggcgaggccgtggccgtcggcaggtatcccgaagacgtatactttaatggaaacccatgg
tatctagctacttatgctgctgcagaacaactatacgatgccatgtatcaatggaacaag
ataggaaaaatcacggtgactgatgtttccatgcctttcttcaaggatatatatcccgaa
gtgcagacagggacacacgagtcttccagcccggagttcggcaatatcattgccgcagtg
aaggcttatgcagaggggtatattgaggttgcaaaaaaatacaccccgtgcacaggaatg
ctgtcagagcagttttccagagataatggaacaccattgtctgtggcggatctcacctgg
tcatatgcatcgtatctaaccgtaatggcccgacgcaactccgtcgttccggcttcctgg
ggagagaagaacgcccgagatatcccatctacttgtgtgccatcatcggcaaccgggcca
taccaaacggctactataacccattggccaccgaacctcacccccactgctcagccgtcg
ccttgccctacggctttgccgacaaagaataatgtccgcttcagactgctcgctacgaca
caggtgggcgaagacgtcttcctggttggatctatcccagagctaggctcgtgggacgtc
aagaaggctgttccgctcaacgccgacatatatgcagacaactgtcaccaatggtatgtt
gacattgagcttccgactgccgtggctttcgagtacaagttcatccgcaagagaggagga
gaggtgatagccttttatcaaatcaatatcctattctacacatcctccctcaaccccgac
atcccgatctacagccaaaagctagccaacaccaccacgcacgcgcagagcttggagctc
gtattcccccatccgcttagcgagacgacaggggctgctagaagagcagacagtgactat
aaaaaggccttcttgcctcctctctcctccccccccatctttcattgttcagtttcatct
gttaactcatctcctcacaggttttcctctacgcttctacgacagaaccgacaaccagca
ctgataccctacgaagaaaagccagaaaaaaaataccaatatacccaagatatggcttca
gttacctctgttcccaagactggacgctcagtcaaccaggacgtgccggcaacgacgctg
acgctgcagacgcgtccaacgcccgcccccaacttcgacgagggcgagcatctcatccgc
gtgcacgccaccgcgctgtgtgcaggcgagctttactggcacacctatgtcacttttacc
aaggaggaaacggtgcccggaccagacgtggcaggcacggtcgtgttggctcctccttcc
tcgccattcaagccaggtgatgatgtttactgccgcattccttattcgcgtgcgggaggt
gcgagggaccacacaatcgcacttacctccgaattggcacgcaaaccaaagaatctgacc
tgggaagaagccgccaccgtgcctctgtccgcccttaccgcctggcaggcacttttcgac
caatctggcttgtgggaggggccagaggacgagagagtgaaagggaagagagttgctgtc
accgcggcgtcgggggcagtcgggatgtggattttgcaatttgcaaggattgccgggttc
gacgctgtaattggaacgtgtggtgatggaaacgaagactttgtcaagtcaatgggagcc
acggacgccgtcaactacaagacaacctcattgaccgcgtgggcagcagagaaacaagga
cgaaaggctgatttggtaatcgactgctttggaggaaagagcctggccgatgcttggggc
tgtgtcaaggatggtggtgtgctgatcagcatggttggatatccggaacaggagaagcca
gctgggcttgaggtgaaggacgtgaagagccactttttcatcatggagcccaggggtgat
cagttgcagaaggttacggagttggtggagcaaggtaaatgttctttcttgatggacagc
gtctacccattggagcaatttcaggaggctacagacaaagtggaaagccgacgtgtcagg
ggcaaagtggtgttgaaggtgctttag

DBGET integrated database retrieval system