KEGG   Trichophyton benhamiae: ARB_03137Help
Entry
ARB_03137         CDS       T01611                                 

Definition
(RefSeq) hypothetical protein
  KO
K02358  elongation factor Tu
Organism
abe  Trichophyton benhamiae
Brite
Translation factors [BR:abe03012]
 Eukaryotic Type
  Elongation factors
   ARB_03137
 Prokaryotic Type
   ARB_03137
Mitochondrial biogenesis [BR:abe03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    ARB_03137
Exosome [BR:abe04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   ARB_03137
  Exosomal proteins of breast cancer cells
   ARB_03137
  Exosomal proteins of colorectal cancer cells
   ARB_03137
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 9525788
NCBI-ProteinID: XP_003010436
UniProt: D4B3U8
LinkDB All DBs
AA seq 438 aa AA seqDB search
MSTLQRSLNVLLRTGKYAAQRPSAVNPMQYVFSHNRMSARGMAAAFERNKPHVNIGTIGH
VDHGKTTLTAAITKRQAEKGFANFLDYGSIDKAPEERKRGITISSAHIEYQTDKRHYAHV
DCPGHADYIKNMITGAASMDGAVVVVAASDGQMPQTREHLLLARQVGVQKLVVFVNKVDA
VEDPEMLELVELEMRELLSHYGFEGEETPIIFGSALCALESRRPELGVEKIDELLNAVDT
WIPTPERATDKPFLMSIEEVFSISGRGTVVSGRVERGILKKDSDVEIVGGSTTPIKTKVT
DIETFKKSCDESRAGDNSGLLLRGIKREDLKRGMVVAAPGSTKAHTDFMVSLYVLTEAEG
GRSNGFTHKYRPQMFIRTADEAASFSWPGEDQDKKAMPGDNVEMICKTLHPIAAEAGQRF
NIREGGRTVATGLITRVL
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtctacccttcagagatccctcaatgtgctgctaaggaccggcaagtacgccgcacag
cggccgtccgctgtcaacccaatgcagtacgtcttctctcacaacaggatgtctgcccga
ggaatggctgctgctttcgagcgtaacaagccccatgtcaacattggtaccattggacac
gttgatcacggaaagaccactttgaccgccgctattaccaagcgccaggccgaaaagggg
ttcgccaatttccttgactacggatccattgacaaggcccccgaggagcgaaagcgtggt
atcaccatctcctccgctcacatcgaataccagaccgacaagagacactatgctcacgtc
gactgtcccggtcacgctgattacattaagaacatgattactggtgctgccagcatggac
ggagccgttgtcgttgtcgcagcttctgacggtcaaatgcctcagaccagagaacatttg
ctccttgcccgccaggtcggtgtccagaagctcgtcgttttcgttaacaaggtcgatgcc
gttgaggacccagagatgttggagcttgtcgaactagaaatgcgtgaactcctcagccac
tacggtttcgagggagaggagacccccatcatctttggctctgccctctgcgccctcgag
tcccgtcgacctgagctgggtgtcgagaagattgacgagctattgaacgccgtcgacacc
tggatccccaccccagagcgcgccactgataagcctttcctcatgtccattgaggaagtg
ttctctatctctggtcgtggtactgtcgtctccggccgtgttgagcgtggtatcctcaag
aaggattccgacgtcgaaattgttggtggttctacgacccctatcaagaccaaggtcacc
gatattgagaccttcaagaagtcctgcgatgaatctcgagctggtgacaattccggtctc
cttctccgaggtatcaagcgtgaggacttgaagcgtggaatggttgttgccgcccccgga
tccaccaaggctcataccgacttcatggtctccctctacgtcctgactgaagctgagggt
ggtcgttccaacggcttcacccacaagtaccgcccacaaatgttcatccgtactgccgac
gaagccgcatctttcagctggcctggagaagaccaagacaagaaggctatgcccggtgac
aacgtcgagatgatttgcaagaccctccatcccattgctgccgaggctggtcaacgattc
aacatccgtgagggtggccgaaccgttgccacgggtttgatcactcgtgtcctctaa

DBGET integrated database retrieval system