KEGG   Trichophyton benhamiae: ARB_04184Help
Entry
ARB_04184         CDS       T01611                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
abe  Trichophyton benhamiae
Pathway
abe00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:abe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ARB_04184
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:abe02000]
    ARB_04184
Enzymes [BR:abe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ARB_04184
Transporters [BR:abe02000]
 Other Transporters
  Pores ion channels [TC:1]
   ARB_04184
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_2 GST_N_3 GST_N GST_C_5 GST_C_2
Motif
Other DBs
NCBI-GeneID: 9524413
NCBI-ProteinID: XP_003017304
UniProt: D4AIT6
LinkDB All DBs
AA seq 282 aa AA seqDB search
MGPPPDADIHPTATGRAKEVVDKHSKEQPLKLYSGWFCPYVSIQRVWIVLEEKKIPYQYI
EVNPYKKPDSLLALNPRGLVPTLACPTIQPDGSTAIKPLYESTVINEYLEDAFPNPERPL
HPADPYQKARGRIWIDHVTSRITPSFYRFLQYQGEEEGLNKAREEFLGHLKDFILEMDEI
GPFFHGSNFMMPDIMLAPLAIRFWVIDHFKKGGLGIPAPGKGGNDEVVWNRWRMWLAAVE
TRESVASTMSDKEHSMPIYKRYADDVAQSELAKATRAGKGVP
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgggacctccccctgatgctgatatccacccaactgcaaccggtcgagcgaaggaggtt
gttgacaagcactccaaagagcagccactcaagctgtactcaggctggttttgcccgtac
gtttcaatccagcgggtatggatcgtcctcgaagagaaaaagatcccatatcaatatatt
gaagtgaatccttataaaaaaccggactctcttcttgcccttaatccacggggcttagta
ccaacgcttgcctgtccaactatccagccagatggatcgactgccattaaaccattatat
gaatccaccgtgatcaatgaatatcttgaagatgcattccccaatccggaacggccattg
cacccggcagatccataccaaaaggcaagggggcgtatctggatcgaccatgtgacctcg
cgaatcaccccttctttttaccgttttcttcaataccagggtgaagaggaggggttgaac
aaagcccgagaagagttcctaggccatttaaaggatttcatcctggaaatggatgagatt
ggtcctttctttcacggaagcaattttatgatgccggatataatgctcgcacctttggcg
attagattctgggttattgaccacttcaagaaaggtgggctaggcataccggctccaggc
aaaggagggaatgatgaagttgtttggaataggtggagaatgtggttggcagcagttgag
acaagggaaagtgtggcttcgactatgagtgataaggaacactctatgcctatttataaa
cgctatgcagatgatgttgctcagagtgaattggcaaaagcaacaagggctggaaagggg
gtaccttga

DBGET integrated database retrieval system