KEGG   Trichophyton benhamiae: ARB_04499Help
Entry
ARB_04499         CDS       T01611                                 

Definition
(RefSeq) hypothetical protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
abe  Trichophyton benhamiae
Pathway
abe00730  Thiamine metabolism
abe00790  Folate biosynthesis
abe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    ARB_04499
   00790 Folate biosynthesis
    ARB_04499
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:abe04147]
    ARB_04499
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:abe00537]
    ARB_04499
Enzymes [BR:abe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     ARB_04499
Exosome [BR:abe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ARB_04499
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:abe00537]
 Enzymes
  ARB_04499
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 9522462
NCBI-ProteinID: XP_003017617
UniProt: D4AJP9
LinkDB All DBs
AA seq 606 aa AA seqDB search
MASNDPRPSNDTDRNDEESTLLTGERVSRTINDDSRRSPNFWRQVGLFTWALVATAAVIV
LAIVYQHDHSLPQDPHRARHTGKRNMIFMVSDGMGPTSLSMTRSFRQHVDKLPIDDILTL
DKHHIGSSRTRSSSSLVTDSAAGATAFACGKKSYNGAISVLPDHSPCGTVLEAAKAAGYM
TGLVVTTRITDATPACFSSHVNIRGYEDLIAEHQLGEYPLGVQVDLMMGGGRCHFLPNST
SGSCRADDKDLVKLAQSKGFHYFDDRKGFDALKKGEAAKLPLLGLLAPTDIPYEIDRRYR
EKEFPSLEEMTKTALKALSDATKNSEHGFFIMIEGSRIDHAGHGNDPAAQVHEVLAYDKA
FAAVLEFLENDSTPGVLVSTSDHETGGLAAARQLHESYPEYLWLPDALANATHSSEYLEP
KLNAYLEGQGHGQSREEKRKHIREKFIKPALGIVDTTDEEIDRLIDNTGRPAAYLFADLV
SRRAQIGWSTHGHSAADVSIFASSPHDALPLVGNHENTEVGGFIATYLDLDLDAITKKLK
GVKTKPSTSSEESASDYSWMGKPLDKNVIVDQLDTYHGDFKRRLRNRGPDENPVHQGRSD
CGCGNH
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaacgaccctcgcccatcgaacgacacggaccgaaacgatgaagagtctacc
cttctgaccggggagcgggtcagccgtactatcaacgatgattcccgtcgtagccctaac
ttctggcgtcaagttggactctttacttgggctctcgtcgctactgctgccgttatcgtc
cttgcaatcgtctaccagcatgaccattccttgccccaagacccccatagagctaggcac
actgggaaacggaacatgatattcatggtatccgatggaatggggcctacaagcttgtct
atgactcgctctttcaggcagcatgttgacaagcttcctatagacgatatcctgaccctg
gacaaacaccatatcggatcatccagaacgaggtcttccagcagcctggtgacagactca
gctgccggagccaccgccttcgcatgtggaaagaagagttataacggtgccatatcggtt
cttcctgaccactcgccctgtggaaccgtcttggaagctgctaaggcagcaggttacatg
accggtttggtcgtcactacacgaatcaccgatgccactcctgcctgcttctcttcccat
gtgaacattcgtggctatgaagatttgattgctgaacatcagcttggtgaataccctctc
ggtgtacaggttgatcttatgatgggtggaggtagatgccacttcctgcccaactctacc
tctgggtcttgtcgtgccgatgacaaggatttggtcaagcttgcgcagtccaaaggcttc
cattactttgatgaccgcaaaggattcgatgctctgaagaaaggcgaagctgccaaactg
ccgttgctaggtctcctggccccaactgacattccttatgaaatcgatcgacgataccga
gaaaaggagttcccatctctagaggagatgactaaaactgccctcaaggcacttagcgat
gccaccaagaatagcgagcatggtttcttcatcatgattgagggctcgagaattgatcat
gctggccatggtaacgacccagctgctcaggtccatgaggttttggcatacgataaggcc
tttgcagctgttctagaattccttgaaaacgactctacccctggtgttctcgtcagtaca
tccgaccacgaaaccggcggtctggccgctgcaagacagctccatgaatcatacccagag
tacctctggcttcccgatgctcttgctaatgctactcattcctctgagtacctcgagccc
aagttgaacgcctacctagaaggacaaggtcatggccaatcccgagaggaaaagcgcaag
catattcgcgagaaattcatcaagcctgctctaggaatcgtcgacaccactgacgaggaa
atcgatcgtcttatcgataacaccggcagacctgctgcatacctttttgccgaccttgta
agtcgcagagcccagataggctggagcacccacggccattctgccgctgatgttagcatc
tttgcttcgtctcctcacgacgctctcccactggttggtaaccacgaaaacactgaagtg
ggcggattcatcgctacctaccttgatcttgacctagatgctatcactaaaaagttgaag
ggtgttaagactaaaccctcaactagcagtgaagaatctgcatccgactactcttggatg
ggcaagccgcttgacaagaatgtgattgtcgaccagcttgatacctatcacggagacttc
aagcgtcgtctaagaaatagaggccctgatgagaaccccgtccatcaaggacgatcagat
tgtggttgtggcaatcattga

DBGET integrated database retrieval system