KEGG   Trichophyton benhamiae: ARB_04626Help
Entry
ARB_04626         CDS       T01611                                 

Definition
(RefSeq) hypothetical protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
abe  Trichophyton benhamiae
Pathway
abe00020  Citrate cycle (TCA cycle)
abe00480  Glutathione metabolism
abe01100  Metabolic pathways
abe01110  Biosynthesis of secondary metabolites
abe01130  Biosynthesis of antibiotics
abe01200  Carbon metabolism
abe01210  2-Oxocarboxylic acid metabolism
abe01230  Biosynthesis of amino acids
abe04146  Peroxisome
Module
abe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abe_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:abe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ARB_04626
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ARB_04626
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    ARB_04626
Enzymes [BR:abe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ARB_04626
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 9522589
NCBI-ProteinID: XP_003017743
UniProt: D4AK25
LinkDB All DBs
AA seq 542 aa AA seqDB search
MAAVRLTSGHFRQGCCWVIRSRCQPTCASASSSSVLNTGSRSFSTVVGRPASISASLSSL
SSLSSSAYVRPALPNALAHQSLVHGRNPYTRNMSAARRKIVVKNPIVELDGDEMTRIIWQ
DIKDKVCCSCPRRYLEVDLKYYDLGLEYRDQTDDQVTVDAAEAIKKYGVGVKCATITPDE
ARVEEFKLKKSKSTTPGYIFYPVLLTPYLSVAISQWNHQKHPQKRVGRLLTHCRGGTVFR
EPIVIPRIPKLVPGWKKPIIIGRHAFGDQYRATDRLIPGPGTLELVYTPAGGEPERIQVY
DFKGPGIAQTQYNLDESIRGFAHASFKLASLKSLPMYMSTKNTILKKYDGRFKDIFQEIY
DKEYKADFEAKGIWYEHRLIDDMVAQMIKSEGGYVIAMKNYDGDVQSDIVAQGFGSLGLM
TSTLTTPDGDAFESEAAHGTVTRHYREHQKGRETSTNPIASIFAWTRGLVRRGQLDETPE
VVNFAEQLERACVEVVDIEGIMTKDLALACGKKDRESWVTTKEYLAAVERRLQKNLGEET
KL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgttcggcttacttccggccatttccgccagggttgctgctgggttatccgc
tcccgctgccagcccacctgcgcctccgcctcttcgtcctctgtattaaacacggggagt
cgctctttctcgacggtcgtgggaaggcctgcatctatatctgcgtctttgtcttctctg
tcttcgttgtcttcgtctgcatacgtgcgtcctgcgctgccgaacgctcttgctcaccag
tctcttgtccacggaagaaacccctacacacgcaacatgtcggctgccaggcggaagatc
gtggtcaagaacccgatcgtcgagctcgatggtgatgaaatgacccgaatcatctggcag
gatattaaggacaaggtatgttgttcatgtccccgcagataccttgaagttgacctcaag
tactatgacctcggccttgagtatcgtgatcagacagacgaccaagtcactgttgatgcc
gcagaggccattaagaagtatggcgttggcgtcaagtgtgccaccatcacccctgacgag
gctagagtggaggagttcaagctgaagaagagcaagtctaccactccgggctatatattc
tatcccgtcttgctaacaccctacctcagtgtggctatctcccaatggaaccatcagaaa
catcctcagaagcgcgtagggagattgctaacacactgcagaggaggaactgtcttccgt
gaacccattgtcatccctcgcattcctaagctcgtccccggctggaagaaaccgatcata
atcggccgtcacgctttcggtgatcagtaccgggccacagaccgcctcatccccggtcct
ggcaccctcgagctcgtttacacacccgccggcggagagccagagcgcatccaggtatat
gacttcaagggccccggtattgcacaaacacagtacaacctcgatgaatccattcgagga
ttcgcacatgccagtttcaagctggctagccttaagagcctgcccatgtacatgagcacc
aagaacactatcctgaagaagtacgatggccgtttcaaggacatcttccaggagatctac
gataaggagtacaaggccgacttcgaggccaagggtatctggtatgagcaccgtctcatt
gacgacatggttgctcagatgatcaagtctgagggaggctatgtcatagccatgaagaac
tacgacggtgacgtccaatccgatatcgttgcccaaggtttcggctctctcggactcatg
acctctaccctgaccacccctgacggtgatgccttcgagtctgaagctgcccatggcact
gtcacccgccactatcgcgaacaccagaagggtcgcgaaacctctaccaaccccatcgca
tctatcttcgcctggacccgaggcctggttcgtcgcggccagctcgacgagactccagag
gttgttaactttgctgagcagcttgagcgtgcttgcgttgaagtcgttgatattgaaggc
atcatgaccaaggatttggccttggcatgcggaaagaaggatagagaaagctgggttacc
accaaggagtaccttgctgctgtcgagagacggctgcagaagaatttgggtgaggagact
aagctgtag

DBGET integrated database retrieval system