KEGG   Trichophyton benhamiae: ARB_05065Help
Entry
ARB_05065         CDS       T01611                                 

Definition
(RefSeq) hexokinase, putative
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
abe  Trichophyton benhamiae
Pathway
abe00010  Glycolysis / Gluconeogenesis
abe00051  Fructose and mannose metabolism
abe00052  Galactose metabolism
abe00500  Starch and sucrose metabolism
abe00520  Amino sugar and nucleotide sugar metabolism
abe01100  Metabolic pathways
abe01110  Biosynthesis of secondary metabolites
abe01130  Biosynthesis of antibiotics
abe01200  Carbon metabolism
Module
abe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
abe_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:abe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARB_05065
   00051 Fructose and mannose metabolism
    ARB_05065
   00052 Galactose metabolism
    ARB_05065
   00500 Starch and sucrose metabolism
    ARB_05065
   00520 Amino sugar and nucleotide sugar metabolism
    ARB_05065
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ARB_05065
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:abe04131]
    ARB_05065
Enzymes [BR:abe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     ARB_05065
Membrane trafficking [BR:abe04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    ARB_05065
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 9522258
NCBI-ProteinID: XP_003016772
UniProt: D4AL68
LinkDB All DBs
AA seq 477 aa AA seqDB search
MVDMPKALLDEIKELEETFTVDTARLKKIVAHFVNELTKGLSVEGGNIPMNVTWVLGFPT
GNEQGTFLALDMGGTNLRVCEIVLSEEKGEFDITQSKYRIPEELKTGTSEELWEYIADCV
QQFIEYHHDGEELPDLPLGFTFSYPATQDYIDHGVLQRWTKGFDIDGVEGEDVVPMLESA
LEKKGLSIKVAALINDTTGTLIASSYTDPEMKIGCIFGTGVNAAYMDNAGSIPKIAHYNL
PPDMPVAINCEYGAFDNERVVLPLTKFDKIIDRDSPRPGQQAFEKMTAGLYLGEIFRLVL
IDIIDNKGGIIFQGQKIDNLRKPYFLDSSFLSAIEEDPFENLSETRDLFERVLGIQATKP
ELELCRRLAELIGTRAARISACGVAAICKKKNIQSCHVGADGSVFNKYPHFKQRGAKALR
EILDWADNEDDKVVMSSAEDGSGVGAALIAALTLERVKAGNLAGVRNKENISQMLKG
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacatgcccaaggcgctgctggacgagatcaaggagctcgaggagaccttcaca
gtcgacacggctaggctcaagaagattgtcgcccacttcgtcaacgagctcactaagggc
ctcagcgttgagggcggcaatatcccgatgaatgttacctgggtgctcggatttcctacc
ggcaatgaacagggtaccttcctggccctcgacatgggcggcaccaacctgcgagtttgc
gagattgtcctctcggaggagaagggagagttcgacatcacccagtccaagtatcgtatc
cccgaggagctgaagactggaacctctgaggagctctgggagtacattgccgactgcgtc
cagcagttcattgaataccaccacgacggagaggagctgccagacctcccactgggcttc
accttctcttaccccgcaacacaggactacatcgaccacggagtcctgcagagatggacc
aagggattcgatatcgatggtgttgaaggagaggacgtcgtccccatgcttgagagtgca
ttggagaagaagggattgtctatcaaagttgcagctttgatcaatgacactaccggaacg
ttgattgcttcctcatacactgatcctgagatgaagattggctgtatcttcggaactggt
gtcaatgccgcatacatggacaacgcgggctcgatacccaagattgcccattataacctg
cccccagacatgcccgtcgccattaactgcgagtacggcgccttcgacaacgagcgtgtt
gtcctgcccctgaccaagttcgacaagatcattgaccgtgactctcctcgtcccggccag
caggcattcgagaagatgactgccggtctctacctaggagaaattttccgtctcgtcttg
attgatatcatcgacaacaagggcggcattatcttccagggccagaagatcgacaatctc
cgaaagccatacttcctcgactcttccttcctctctgccattgaggaggatccgtttgag
aacttgtctgaaacccgcgacctgttcgagcgtgtccttggaatccaggctaccaagcca
gagctcgaactgtgcagacgtctggccgaacttatcggtactagagctgcacgtatctct
gcctgcggtgtagctgccatctgcaagaagaagaacatccaatcctgccatgttggtgct
gacggttcagtcttcaacaagtacccccatttcaagcagcgaggtgccaaggcccttcgt
gagatccttgactgggccgataacgaggacgacaaggtagtcatgagctccgccgaggac
ggttctggtgttggagctgctctcattgctgccctgaccctcgagcgtgtcaaggctggc
aacttggctggtgtccggaacaaggagaacataagccagatgctcaagggttag

DBGET integrated database retrieval system