KEGG   Trichophyton benhamiae: ARB_05408Help
Entry
ARB_05408         CDS       T01611                                 

Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
abe  Trichophyton benhamiae
Pathway
abe03030  DNA replication
abe03410  Base excision repair
abe03420  Nucleotide excision repair
abe03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:abe00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    ARB_05408
   03410 Base excision repair
    ARB_05408
   03420 Nucleotide excision repair
    ARB_05408
   03430 Mismatch repair
    ARB_05408
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:abe03032]
    ARB_05408
   03400 DNA repair and recombination proteins [BR:abe03400]
    ARB_05408
Enzymes [BR:abe01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     ARB_05408
    6.5.1.6  DNA ligase (ATP or NAD+)
     ARB_05408
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     ARB_05408
DNA replication proteins [BR:abe03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    ARB_05408
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     ARB_05408
DNA repair and recombination proteins [BR:abe03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     ARB_05408
   NER (nucleotide excision repair)
    Other NER factors
     ARB_05408
   MMR (mismatch excision repair)
    Other MMR factors
     ARB_05408
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 9523919
NCBI-ProteinID: XP_003016011
UniProt: D4AMF5
LinkDB All DBs
AA seq 844 aa AA seqDB search
MAGPLKKKRKVDSTGVPQNTRSIASYFRAGNKATSSQIISTEHHRLTDEQLARKLQKEWN
KKSQDESESSTPGHRATENLQEEKLRASDEVADASSSSDKGSLADTPALTPGKENKPKGI
LSLQSSSTAEDTISFSLPFDLSPLEFDPHEQKEKLQAHWDAEGGKASYAILARAFSLVNG
TQSRIKIVDILVNLLRLIIVGDPQSLLPAVWLATNAFAPPYVPIELGLGGSAISKALKRA
YGLDNQGLKALYNKHGDAGDVAFEAKKKQSFTLRRPKPLTIRSVYDALMKIANSKGTGSQ
ETKQRIVEKLLQDTRGAEESRYIVRTLVQHLRIGAVKTTILIALARAFLYSKPPAATFPL
RSRAELMSLSKEELSNIYSQAEETIKACYARHPNYNMIVPCLLENGVSAELLTKCGITLH
VPLLPMLGSITRDLPQMLTRLHGRSFTCEYKYDGQRAQVHCDAAGKVSIFSRHLELMTDK
YPDLVSLVPQIRSGAVSSFIMEGEVVAVNNETGELLPFQTLTNRAKKNVEIGSIKVNVCL
FSFDLMYLNGQPLLDRTFRERRELLRSLFVEIPNQFTWVKSIDAFPSDSDAVLNFFNDAL
QVKCEGIMVKVLDDKPVDRLLQAEDTATALGDGELLPPEEDKKQESTDTAEKQRGNRKRP
LLSTYEPDKRLESWLKVKKDYSASSETLDLIPIAAWHGQGRKAKWWSPILLAVRNPETGS
LEAVTKCMSGFTDKFYEANKEKYAEGSDNIISRPSYVEYCGEPEVWFQPQEVWEMAFADI
TLSPTYTAAIGLVSDERGLSLRFPRFLRVREDKSIDEASTSDYLAHLWDKQAERAKVAEP
RAGD
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atggccggtcctttaaaaaagaagagaaaggttgattcgactggggtgccgcagaatacc
cggagcattgcttcatattttcgtgcagggaataaagcaacgtcctcgcaaatcattagc
accgagcatcatcggcttacggacgagcagctggcccggaagcttcaaaaagaatggaat
aaaaaaagccaggatgaatctgaatcttccactcctggtcatagagcaacggaaaacctt
caagaagaaaaactgcgagcgtctgatgaagtagctgatgcgagctcaagcagcgacaaa
ggcagcttagctgatactccagctcttacacccggaaaagagaacaagcccaagggaata
ctatctctacagagctcttcaacggctgaggataccatatcattttcattgccttttgat
cttagtccgttggaattcgatccacatgaacaaaaggagaaactccaggcacactgggat
gcggaaggcgggaaagcatcgtatgccattttagctcgtgccttttctcttgtcaatggc
acacagagtaggattaaaatagtggacattcttgtgaaccttcttaggcttataatcgtt
ggtgacccgcagagccttcttcccgcggtgtggttggcaacaaatgcatttgctccgccc
tacgtaccaattgaactggggctaggagggtctgccatatccaaagcattgaaaagagca
tatgggctggataaccagggtctcaaagcactttacaataaacatggcgatgctggcgat
gtggcctttgaagcaaagaaaaagcagtcatttacgctgagacgaccaaagccgttaacc
atcagaagtgtatacgatgcgctgatgaaaattgcgaacagcaaaggcacaggaagtcag
gagacaaagcaaagaattgtcgagaaattgctccaagacacgcgaggtgcagaggagagt
cgatacatcgttcgtacacttgttcagcatctccggattggagctgttaaaacgacgatt
ttgattgcacttgcaagagcgtttctctactcaaaaccgccggcagccacatttccccta
cgttcgcgcgcagagctcatgagcttgagtaaagaggagttatcaaatatctactcccag
gctgaagagactatcaaagcttgctatgcccggcatcctaactacaacatgattgttcca
tgtttattggaaaatggggtttctgctgaacttcttacgaaatgtggcatcacattacac
gttcctttattacctatgttgggtagtattacacgggaccttccgcaaatgttaaccagg
ctacatggccgatcctttacctgcgagtacaaatatgatgggcaaagggcacaggtacac
tgcgatgcagcggggaaggtctccattttctctcgccatttagaactcatgacggataaa
tacccggacttagtgtctcttgtccctcagattcgatctggagctgtttctagctttatt
atggaaggtgaagtggttgctgttaataatgaaaccggagaattgcttccttttcaaaca
ctcacgaatcgggcgaagaaaaatgtggaaataggtagtatcaaagtcaatgtctgttta
ttctcttttgacttgatgtacctgaatggacagcctctgcttgacagaacattccgggaa
agacgagaacttctaaggagtttgttcgttgagatcccaaatcaatttacatgggtaaag
agtatagatgcattcccatctgattcggacgctgttctgaactttttcaatgatgccctt
caagtaaaatgcgagggcataatggttaaagttctggatgataagccagttgaccgcctg
ttgcaggcagaagataccgccacagctcttggtgatggtgaattactacctcccgaagag
gataaaaaacaagagtctacggatactgctgagaagcagcgagggaacaggaaacggccg
ctgctgtcaacatacgagcctgacaaacgcctcgaatcttggcttaaagtgaagaaggat
tatagtgcttcttcggagaccttagacttgattcccattgcggcatggcatggccaaggt
cgaaaggccaaatggtggtctccaatacttcttgctgtgcgaaatcctgaaaccggctct
ctcgaggcagttaccaagtgtatgtccggtttcactgataagttttatgaagcgaataag
gagaagtatgcggaaggcagcgacaatataatctcacggccaagctacgtggagtactgt
ggcgagccggaggtttggtttcaacctcaggaggtgtgggagatggcctttgcagatatc
acgctgagtcctacgtatactgcagccataggcctggttagtgatgaacgcgggctgagc
cttcgattcccaaggttcttgagagtgagagaggacaagagcattgatgaagctagcaca
tccgactatcttgcccatctttgggacaagcaggcggagagagcaaaggtggcggagcct
cgagctggggattga

DBGET integrated database retrieval system