KEGG   Trichophyton benhamiae: ARB_05411Help
Entry
ARB_05411         CDS       T01611                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
abe  Trichophyton benhamiae
Pathway
abe00250  Alanine, aspartate and glutamate metabolism
abe00410  beta-Alanine metabolism
abe00430  Taurine and hypotaurine metabolism
abe00650  Butanoate metabolism
abe01100  Metabolic pathways
abe01110  Biosynthesis of secondary metabolites
Module
abe_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:abe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ARB_05411
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ARB_05411
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ARB_05411
   00430 Taurine and hypotaurine metabolism
    ARB_05411
Enzymes [BR:abe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     ARB_05411
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS
Motif
Other DBs
NCBI-GeneID: 9523922
NCBI-ProteinID: XP_003016014
UniProt: D4AMF8
LinkDB All DBs
AA seq 546 aa AA seqDB search
MERPEEVRKERVVGFVEQADRASQVPGQKNNDDSRPKILDFKPPEELKAVFSEGLTSSGQ
GHDGLVRIVDDLLKYSVNTWQQGFLDKLYSSPNAPGLAAELLLGTLNANVHVYQSAPALT
VIEKVTTRRFAELFGLTGPNAGGISVQGGSASNTTAIVVARNTLFPDTKKNGTGDHRFVI
FTSAHGHYSIEKAAQMIGLGSNAVHSVPVDREGRMIPQKLDEEIQKAKDDGKTPLFVNAT
AGTTVLGTFDPFTEIAGICRKHKIWFHIDGAWGGAFIFSNRQKHKLEGSHMADSIAINPH
KMLGVPLTCSFLLGADMTQFHGSNTLPAGYLFHNDVSDGSEVWDLGDLTLQCGRRGDALK
MFLNWNYIGSSGYEERIDAASDVAVHLCNLISESPDLILLSENPPPCFQICFFYAPFKQM
VHSSDKVADEAERGKLNGEITSMIADDLIEQGFMVDYAPPAAAQVEGDGKYLRCVINLHT
KKETVERLVEVVLQLGAKAVRKQRGLELNGTFVNPNQAPAPGQRPKHPLEMGRGPQGAPA
ASDFVL
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggagcggcctgaagaagtgcggaaagaacgcgttgttggatttgttgagcaggcagat
cgcgcgtcccaggtaccaggacagaagaataatgatgattctcggccaaagattctggat
tttaagcccccggaagagctcaaagcagtgtttagtgaaggcttaacaagctcaggacag
ggacatgatgggcttgttcgaattgtagatgaccttctcaaatattccgtcaacacatgg
cagcaaggatttctggacaagctttactcatcaccaaacgctcctgggttggccgcagag
ttacttcttgggacattgaatgccaatgtgcacgtctaccagtcggccccagcattgacg
gtcatcgaaaaagtgaccacaagacgatttgctgagcttttcggtcttacaggacccaac
gctggcggaatctctgtccagggagggtctgcatccaacactacagcaatcgttgtagca
aggaacactctatttcccgataccaagaagaatggaacgggtgaccatcgatttgttata
tttaccagtgcgcatgggcactacagcattgaaaaagctgcgcaaatgatcggcctagga
agcaacgcggttcacagtgtacctgtcgaccgtgaaggacgaatgattccacagaagctt
gatgaggagattcagaaggcaaaggacgatggtaaaactcccctcttcgtcaatgccact
gccgggactactgttctagggacatttgatccatttacggaaatcgcggggatttgccgc
aaacataaaatctggttccacattgatggtgcttggggaggtgcttttatcttttctaac
cgccagaaacacaagcttgaaggttcacatatggctgatagtattgccataaatcctcat
aaaatgcttggagtaccattgacttgctcgttcctattgggcgccgatatgactcaattc
cacggatcaaacacgcttcctgcagggtatctcttccataacgatgtgtctgatggctcc
gaggtatgggatttgggtgacttgactttacaatgcggccgtcgaggtgatgccctgaaa
atgttcctaaactggaattacatcggctcatcaggatacgaagaacgaattgatgctgca
agtgatgtcgctgtccatctctgcaacctcatatcggaatccccggatttaattctcctt
agtgaaaatccaccaccatgctttcaaatatgtttcttctatgcaccgttcaaacagatg
gtccacagttccgacaaagtggcagatgaggcagaacgtggaaaacttaacggagagatt
acttccatgattgccgatgatctgatcgaacaaggatttatggttgactatgcaccacca
gctgcagcccaagttgaaggagacggcaaatatcttagatgtgtcatcaatcttcacact
aagaaagaaacagtcgagcgactcgtcgaagtagtcttgcaattgggtgccaaagcggtc
aggaagcagcgtggactcgagttgaacgggacctttgtaaatccgaaccaggctccagca
cctggccagcgaccaaagcaccctcttgagatgggtcgtgggcctcaaggcgctccggct
gcctcggatttcgtgctttga

DBGET integrated database retrieval system