KEGG   Trichophyton benhamiae: ARB_06591Help
Entry
ARB_06591         CDS       T01611                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
abe  Trichophyton benhamiae
Pathway
abe00020  Citrate cycle (TCA cycle)
abe00190  Oxidative phosphorylation
abe01100  Metabolic pathways
abe01110  Biosynthesis of secondary metabolites
abe01130  Biosynthesis of antibiotics
abe01200  Carbon metabolism
Module
abe_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abe_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
abe_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:abe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ARB_06591
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ARB_06591
Enzymes [BR:abe01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ARB_06591
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 9521192
NCBI-ProteinID: XP_003015465
UniProt: D4AQT1
LinkDB All DBs
AA seq 597 aa AA seqDB search
MDIIFLGDHEFDAVVVGAGGAGLRAAFGLAEAGFNTACVTKLFPTRSHTVAAQGGINAAL
GNMHKDDWRWHMYDTVKGSDWLGDQDAIHYMTREAPQSVIELEGYGCPFSRTEDGRIYQR
AFGGQSQDYGKGGQAYRCCAAADRTGHALLHTLYGQSLRHNANYFIEYFAMDLLMEDGEC
KGIIAYNQEDGTLHRFRAHHTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLE
FVQFHPTGIYGAGCLITEGSRGEGGYLLNSNGERFMEKYAPTAKDLASRDVVSRSMTMEI
REGRGVGPDKDHIYLQLSHLPAEILHERLPGISETASIFAGVDVTKQPIPVLPTVHYNMG
GIPTKYTGEVLTLDENGNDKVVPGLYACGEAACVSVHGANRLGANSLLDLIVFGRAVSHT
VRDNASPGAPHKEISADAGAESIAALDKIRTSDGSKSTFEIRNAMQRTMQSDVSVFRTQE
SLDEGVTKITEVDQMFADVNIKDRSMIWNSDLVETMELRNLLTCATQTAVAAANRKESRG
AHAREDYPERDDVNWMKHTLTFQKQPHGKIDLTYRAVNGHTLDEAECKAVPPFKRTY
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggacatcatcttcctcggtgaccatgaattcgatgccgttgtcgttggtgctggtggt
gccggtctgagagccgccttcggccttgcggaggctggattcaacaccgcgtgtgttaca
aaacttttccccacgagaagtcacactgttgctgctcagggaggtataaatgcggctctt
ggaaacatgcacaaggacgactggagatggcacatgtacgatacggttaagggttccgac
tggcttggtgaccaagatgctatccattacatgacgagagaagccccccagagtgttatc
gaactcgagggttacggatgtcctttctcgcgaactgaggacggacgtatctaccagcgt
gctttcggtggacaatcgcaagattacggaaagggaggtcaggcttaccgatgctgcgca
gctgctgacagaaccggccacgctctcctccacaccctctacggtcaatctctccgccac
aatgccaactacttcatcgagtacttcgctatggatctcttgatggaggacggtgaatgt
aaaggaattatcgcctacaaccaggaggacggtactcttcacagattccgcgctcaccac
actgtccttgctaccggtggatatggccgtgcctacttcagctgtacctccgcccacact
tgcactggtgacggtatggctatggttgctcgtgctggacttcccaaccaggatctggaa
ttcgtgcaattccaccctactggtatctacggtgctggttgtctgattactgagggctcc
cgtggtgagggtggctaccttcttaactcaaacggtgaacgattcatggagaagtatgcc
ccaactgctaaggatctggcctctcgtgatgtcgtctcccgatccatgaccatggaaatc
cgcgagggccgtggtgttggcccagacaaggaccacatctacctccagctgagccatctt
cccgccgaaattctccacgagcgactccccggtatctctgagactgcttctatcttcgct
ggtgtcgatgttaccaaacagccaattcccgttctcccaactgtccactacaacatgggt
ggtatcccaaccaagtacactggtgaggtcctcactctcgacgagaacggaaacgacaaa
gttgttcccggtttgtatgcctgcggtgaagccgcatgtgtctctgtccacggtgccaac
cgtcttggagccaactcccttctcgatctcatcgtcttcggccgtgctgtctctcacacc
gttagggacaacgcctcccccggtgccccccacaaggagatcagcgctgatgctggtgct
gagtctattgctgctttggacaagatcagaacttccgatggatccaagtctaccttcgag
attagaaatgctatgcagaggactatgcagtctgatgtcagtgttttccgaactcaagag
agtttggatgagggtgttaccaagatcactgaggttgatcaaatgtttgccgatgttaac
atcaaggaccgcagcatgatctggaactctgacttggttgagaccatggagctgaggaac
ttgttgacttgcgctacccaaaccgccgttgctgccgccaaccgcaaggaatctcgtggt
gctcacgcccgtgaagattaccctgagcgagacgacgtcaactggatgaagcacactctt
accttccagaagcaaccccacggtaagattgatctcacataccgtgccgtcaacggacac
actctcgacgaggccgagtgcaaggctgtcccaccattcaagcgtacatactag

DBGET integrated database retrieval system