KEGG   Azospirillum brasilense Sp7: AMK58_02275Help
Entry
AMK58_02275       CDS       T04566                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
abf  Azospirillum brasilense Sp7
Pathway
abf00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:abf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AMK58_02275
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:abf02000]
    AMK58_02275
Enzymes [BR:abf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AMK58_02275
Transporters [BR:abf02000]
 Other Transporters
  Pores ion channels [TC:1]
   AMK58_02275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_C_2 GST_C_3 GST_N_3 GST_N_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: ALJ34342
UniProt: A0A0P0EQQ3
LinkDB All DBs
Position
502622..503227
Genome map
AA seq 201 aa AA seqDB search
MKLYLKPGACSLSPHIVLRESGLAFDVAAVDLAAKKLEDGSDFLAVNPKGQVPTLAFDDG
AILTEGAAIVQYVADRVPETGLLPAVGTMERYRVLEWLNFIGTELHKTFSPLFRPTTPDA
YKDIAKQTLTAKFAAVEAGLAGKDYLTGDRFTVADAYGFTVLRWAPRVGLPLDGYPNITA
YMARVAGRPAVAAALAAEGIA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctacctgaagccgggcgcctgctcgctgtcgccgcacatcgtcctgcgcgaa
agcggtctggccttcgacgtcgcggccgtcgacctcgccgccaagaaactggaggacggc
agcgatttcctggccgtcaacccgaagggccaagtgccgacgctggccttcgacgacggc
gccatcctgaccgagggcgccgccatcgttcagtacgtcgccgaccgcgtgccggagacc
ggtctgctgccggccgtcgggacgatggagcgctaccgcgttctggagtggctgaacttc
atcggcacggagttgcacaagaccttcagcccgctgttccgcccgaccacgccggacgcc
tacaaggatatcgccaagcagacgctgacggccaagttcgcggccgttgaggccgggctg
gccggcaaggactatctgaccggcgaccgcttcacggtggccgacgcctatggattcacg
gtgctgcgctgggcgccgcgggtcggcctgccgctggacggctacccgaacatcaccgcc
tacatggcccgcgtcgccgggcgtccggctgtggcggcagcgctggcggcggaagggatc
gcctga

DBGET integrated database retrieval system