KEGG   Azospirillum brasilense Sp7: AMK58_03905Help
Entry
AMK58_03905       CDS       T04566                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
abf  Azospirillum brasilense Sp7
Pathway
abf00473  D-Alanine metabolism
abf00550  Peptidoglycan biosynthesis
abf01100  Metabolic pathways
abf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:abf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AMK58_03905
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AMK58_03905
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    AMK58_03905
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:abf01011]
    AMK58_03905
Enzymes [BR:abf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AMK58_03905
Peptidoglycan biosynthesis and degradation proteins [BR:abf01011]
 Precursor biosynthesis
  Amino acid ligase
   AMK58_03905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 ATP-grasp B12-binding
Motif
Other DBs
NCBI-ProteinID: ALJ34634
UniProt: A0A0P0F632
LinkDB All DBs
Position
complement(865267..866217)
Genome map
AA seq 316 aa AA seqDB search
MTTPHKKHVAVLMGGWSAEREVSLVSGAGVAKALEEEGYRVTAVDVQRDLEGLLRALTDP
RPDAVFNALHGRGGEDGTIQGVLEFLGIPYTHSGVRAAAVAMDKAMTKALLAPVGVRSPK
GLVLTKGELTGGAHPMPAPYIVKPVDEGSTVGVTLVREGQNSPVGDAWTFGERALVEEFI
PGRELTVGVMGGLDGECRPLTVTEIRFEAQVYDYTAKYSAGHAVHTVPAQIPEHVAEEAK
RLAVLAHRTLGCRGVSRSDFRWDDRKSGTDGLFFLEINNQPGMTPLSLVPEQAASVGLTY
GALVAWMVENAACQLD
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccccccacaagaagcatgtcgccgtcctgatgggcggctggtcggcggagcgc
gaggtgtcgctggtcagcggcgccggcgtcgccaaggcgctggaggaggaaggctaccgc
gtcaccgcggtggacgtgcagcgcgacctggaggggttgctgcgcgcgctgaccgacccg
cgtcccgacgcggtgttcaacgccctgcacgggcgcggcggcgaggacgggacgatccag
ggcgtgctggaattcctcggcatcccctacacccattccggcgtgcgcgccgccgcggtc
gccatggacaaggcgatgaccaaggcgctgctcgccccggtcggcgtgcgctcgcccaag
ggcctcgtcctgaccaagggcgagctgaccggcggcgcccacccgatgcccgccccctac
atcgtcaagccggtggacgaaggctcgaccgtcggggtcacgctggtgcgcgaggggcag
aacagcccggtcggcgacgcctggaccttcggcgagcgcgccctggtcgaggagttcatc
ccgggccgcgagctgaccgtgggcgtcatgggcgggctggacggcgaatgccgccccctg
accgtgacggagatccgctttgaagcacaggtgtatgactacacggctaaatacagcgcc
ggtcatgccgttcatactgtgcccgcgcagattcccgagcatgtcgcggaagaagccaag
aggttggcggtcctggcccatcggaccctggggtgccgcggcgtttcgcgcagcgacttc
cgctgggatgatcgtaaaagtgggaccgacggactctttttcctggaaatcaacaaccag
ccgggcatgacgccgctgtcgctggttcccgaacaggccgcatccgtggggctcacctac
ggggctctcgtcgcttggatggtggagaacgccgcatgtcaactcgactga

DBGET integrated database retrieval system