KEGG   Azospirillum brasilense Sp7: AMK58_11270Help
Entry
AMK58_11270       CDS       T04566                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
abf  Azospirillum brasilense Sp7
Pathway
abf00500  Starch and sucrose metabolism
abf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AMK58_11270
Enzymes [BR:abf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AMK58_11270
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     AMK58_11270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C hDGE_amylase MIIP
Motif
Other DBs
NCBI-ProteinID: ALJ35949
UniProt: A0A0P0F977
LinkDB All DBs
Position
complement(2439800..2441488)
Genome map
AA seq 562 aa AA seqDB search
MIKDLWYKNAVIYNLSLGTFMDANGDGIGDFQGLQRRLDYLQGLGVTCVWLGPFQPSPMR
DHGYDVADYYNVDPRYGTLGDFVEFSHACKQRGIRLIIDLVVNHTSDQHPWFQAARKDPG
SPYRDWYVWSDKKPSDADQGVVFPGVQKTTWSWDKEARAYYFHRFYEFQPDLNTANPEVQ
AELLKVMGFWIELGVSGFRMDAVPFVIATKGPDVKKPKQQFDMLRTFREFVQWRCGDAVL
LAEANVLPTVDQEYFGDDGDRMQMVFNFQVNQTLFYALATADTRPLAKALDVTRVPRPST
NQWGLFLRNHDELDLGRLTEAQRKRVFDAFGPDKDMQLYDRGIRRRLAPMLRGDRRWLEL
AYSLLFTLPGTPVLRYGDEIGMGDDLSLPERECARTPMQWSNEPQGGFTKADDPVHPVIS
GGAYGYERINAAHQRREPSSLLNWTERIIRMRKECPEIGWGDFQVLPTGSNAVLAIRYDW
RNNSVLVVHNLDDRPHEVVLAVDGAGKSPRLVNLLAEDHNDPEEDGRHRLVLEPYGYRWY
RLGGLDYLLRRTEGPVGGAKRS
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaggatctctggtataagaacgcggtcatctacaacctgtcgctcggcaccttc
atggacgccaacggcgacgggatcggcgatttccaagggttgcagcgccggctggactat
ctgcaggggctgggcgtgacctgcgtctggctgggaccgttccagccgtcgccgatgcgc
gaccacggctacgacgtggccgactactacaacgtcgatccgcgctacggcacgctgggc
gacttcgttgagttcagccacgcctgcaagcagcgcggcatccgtctcatcatcgacctc
gtggtcaaccacacgtcggaccagcacccctggttccaggcggcgcgaaaggacccaggc
tccccctaccgggactggtacgtgtggtcggacaagaagccgtccgacgccgaccagggc
gtcgtctttcccggcgtgcagaagacgacctggagctgggacaaggaggcccgcgcctac
tacttccaccgcttctacgagttccagcccgacctgaacaccgccaacccggaggtgcag
gccgagctgctgaaggtgatgggcttctggatcgagctgggtgtgtcgggcttccgcatg
gacgccgtgcccttcgtcatcgcgaccaaggggccggacgtgaagaagcccaagcagcag
ttcgacatgctgcgcaccttccgagagttcgtgcagtggcggtgcggcgacgccgtgctg
ctggccgaggccaacgtgctgccgaccgtcgatcaggagtatttcggcgacgacggcgac
cgcatgcagatggtcttcaatttccaggtcaatcagaccctgttctacgcgctggcgacg
gcggacacgcggccgctggccaaggcgctggacgtcacccgggtgccgcgccccagcacc
aaccagtggggcctgttcctgcgcaaccacgacgagctggacctcggccgcctgaccgag
gcgcagcgcaagcgcgtgttcgacgcgttcgggccggacaaggacatgcagctctacgac
cgcggcatccggcggcggctggccccgatgctgcgcggcgaccggcgctggctggaactg
gcctacagcctgctgttcacgctgcccggcacgccggtcctgcgctacggcgacgagatc
ggcatgggcgacgacctgtccctgccggagcgcgagtgcgcccgcaccccgatgcagtgg
tcgaacgaaccgcagggcggcttcaccaaggcggacgaccccgtgcacccggtcatcagc
ggcggcgcctacggctatgagcggatcaacgccgcccaccagcgccgcgagccgtcgagc
ttgctgaactggaccgagcgtatcatccgcatgcgcaaggaatgcccggagatcggctgg
ggcgacttccaggttctgcccaccggatcgaacgcggtgctggcgatccgctacgactgg
cggaacaactcggtgctcgtcgtccacaaccttgacgaccgcccccacgaggtcgtgctg
gcggtcgatggcgcggggaaatcgccgcggctggtcaatctgctggccgaggaccacaac
gaccccgaggaggacgggcggcaccgcctggtgctggagccctacggctaccgctggtac
cggctgggcgggctggactatctgctgcgccggacggaggggccggtcggtggggcgaag
cggtcttga

DBGET integrated database retrieval system