KEGG   Azospirillum brasilense Sp7: AMK58_16895Help
Entry
AMK58_16895       CDS       T04566                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
abf  Azospirillum brasilense Sp7
Brite
Enzymes [BR:abf01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AMK58_16895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ALJ37173
UniProt: A0A0P0EDN1
LinkDB All DBs
Position
ABSP7_p1:complement(687952..688557)
Genome map
AA seq 201 aa AA seqDB search
MAFELPPLPYGYDALQPFMSSETLHLHHDKHHQTYVTNLNNLTKDSPLADASLEDVIKQS
YGDASKQGLFNNAGQVWNHTFYWQSMKKNGGGAIPGELEKRLIADFGSVDKFKEEFSNAA
ITQFGSGWAWLYLDGGKLKVTKTSNADTPLAQGHFPLLTADVWEHAYYVDYQNRRADFVK
AFLESLVNWEFVAERLSKAPA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcgaactgccgccgctcccgtatggctatgatgctctgcagccgttcatgtcg
tcggagacgctgcacctgcaccacgacaagcaccaccagacctacgtcaccaacctcaac
aacctgacgaaggacagcccgctggccgacgccagcctggaagacgtcatcaagcagagc
tacggcgacgcctccaagcagggcctgttcaacaacgccggtcaggtgtggaaccacacc
ttctactggcagagcatgaagaagaacggtggcggcgccatcccgggcgagcttgagaag
cgcctgatcgccgacttcggcagcgtcgacaagttcaaggaagagttctcgaacgccgcc
atcacccagttcggctcgggctgggcgtggctgtacctcgacggcggcaagctgaaggtc
accaagacctccaacgccgataccccgctggcccagggccacttcccgctgctgaccgcc
gacgtgtgggaacacgcctactacgtcgactaccagaaccgccgcgcggacttcgtgaag
gcgttcctggagagcctggtgaactgggaattcgtggccgagcgcctgtcgaaggccccg
gcctga

DBGET integrated database retrieval system