KEGG   Azospirillum brasilense Sp7: AMK58_17645Help
Entry
AMK58_17645       CDS       T04566                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
abf  Azospirillum brasilense Sp7
Pathway
abf00010  Glycolysis / Gluconeogenesis
abf00020  Citrate cycle (TCA cycle)
abf00620  Pyruvate metabolism
abf01100  Metabolic pathways
abf01110  Biosynthesis of secondary metabolites
abf01120  Microbial metabolism in diverse environments
abf01130  Biosynthesis of antibiotics
abf01200  Carbon metabolism
Module
abf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:abf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMK58_17645
   00020 Citrate cycle (TCA cycle)
    AMK58_17645
   00620 Pyruvate metabolism
    AMK58_17645
Enzymes [BR:abf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AMK58_17645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N QRPTase_N
Motif
Other DBs
NCBI-ProteinID: ALJ37302
UniProt: A0A0P0EXT0
LinkDB All DBs
Position
ABSP7_p1:complement(857414..858754)
Genome map
AA seq 446 aa AA seqDB search
MTIQILMPALSPTMTEGNLAKWLKKEGDAVKSGDVIAEIETDKATMEVEAADEGRLGKIL
VQAGTQGVAVNTPIAVLLEEGEDDSALAKAAAPAPAPAAAPAAAPAPAASASAAAPAPQA
AAAPAPAAQGGGRVFASPLARRLAEQAGLDLKAVKGTGPNGRIVKADIEAAKAGGTAKAA
APQAAAPAPAAVPAAAPAAAAPAPKAAGIDAKDLSDKLGMRYKAQPNSSMRKTISRRLTE
VQQTVPDYFLAIDCELDALLKVRSDLNARSKDYKLSVNDFIIRAAALTLKKFPNINAAWS
EEAILRYDHVDISVAVATPTGLITPIVKKAETKGLAEISNEMKGLAERARDGKLKPEEYQ
GGTFSISNLGMYGIREFAAIINPPQACIMAVGAGEQRPVVKNGALAIATVMTVSVTVDHR
VADGAQGAEFLAAFKKLIEDPLSMLL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccagattctcatgcccgccctctctccgaccatgaccgagggcaacctcgcg
aagtggctgaagaaggaaggcgacgcggtgaagtccggcgacgtgatcgccgagatcgaa
accgacaaggccaccatggaagtcgaggcggccgacgaaggccgtctcggcaagatcctc
gtgcaggccggcacgcagggcgtcgcggtgaacaccccgatcgccgtgctgctggaagag
ggcgaggacgacagcgcgctcgccaaggccgctgcccccgctcccgctccggcggctgcg
cccgcggcggctccggccccggcggcttccgcttcggcggctgccccggctccgcaggcc
gcggctgctccggctcccgccgcccagggcggtggccgcgtgttcgccagcccgttggcc
cgccgtctggccgagcaggccggtctcgacctgaaggccgtcaagggcaccggcccgaac
ggccgcatcgtcaaggccgacatcgaggccgccaaggccggcggcaccgccaaggccgcc
gctccgcaggctgccgctccggctcccgccgcggtcccggcggctgcgccggccgccgcc
gctccggctccgaaggccgcgggcatcgacgccaaggacctctcggacaagcttggcatg
cgctacaaggcgcagccgaacagctccatgcgcaagacgatctcccgtcgtctgaccgag
gtgcagcagacggtgccggactacttcctggccatcgactgcgaactggacgcgctgctg
aaggtccgttccgacctgaacgcccgctccaaggactacaagctgtcggtcaacgacttc
atcatccgcgccgccgcgctgacgctgaagaagttcccgaacatcaacgccgcctggtcg
gaagaggccatcctccgttacgaccacgtcgacatctcggtcgccgtggccaccccgacc
ggcctgatcacgcccatcgtcaagaaggcggagaccaaggggctggccgagatctccaac
gagatgaagggtctggcggagcgcgcccgcgacggcaagctgaagccggaagagtaccag
ggcggcaccttctcgatctccaacctcggcatgtacggcatccgggagtttgcggcgatc
atcaacccgccgcaggcctgcatcatggcggtcggcgccggcgaacagcgtccggtcgtg
aagaacggcgcactcgccatcgccaccgtgatgaccgtctcggtcaccgtggaccaccgc
gtcgccgacggcgcgcagggtgcggaattcctcgcggctttcaagaagctgatcgaggac
ccgctgagcatgctgctgtaa

DBGET integrated database retrieval system