KEGG   Azospirillum brasilense Sp7: AMK58_19130Help
Entry
AMK58_19130       CDS       T04566                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
abf  Azospirillum brasilense Sp7
Brite
KEGG Orthology (KO) [BR:abf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AMK58_19130
Enzymes [BR:abf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AMK58_19130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 FAD_oxidored HI0933_like AlaDh_PNT_C FAD_binding_3 DAO Glutaredoxin NAD_binding_7 NAD_binding_8 Thi4 K_oxygenase FMO-like DUF3467
Motif
Other DBs
NCBI-ProteinID: ALJ37560
UniProt: A0A0P0FD25
LinkDB All DBs
Position
ABSP7_p1:complement(1198021..1199601)
Genome map
AA seq 526 aa AA seqDB search
MLDSNVKGQLKAYFDKITQPIELAASLDDGAKSQDMQALLQDIASLSDKITFVRTDDDAR
KPSFAIKRTGTDIGVRFAGLPMGHEFNSLILALLQVGGHPSKESAEVIEQVKALEGEYRF
ETYFSLSCQNCPDVVQALNLMSVLNPRIKHVAIDGALFQQEVDSRKIMAVPSIFLNGEPF
GQGRMGLEQILAKIDTGASQRDAEKIKAKDAFDVLVIGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVSHTEGPKLATALEQHVKEYEVDVMNLQRADKLIPAEGPGG
LIEVQLANGASLKSKTVILSTGARWRQMGVPGEDEYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAEVTLIEFDSQLRADEVLQRKLRSLPNVRVITSGLTTEVHGDG
TKVTGLSYKNRNTSEVHRIDLEGIFVQIGLVPNTEWLKGAVALSPRGEIEVDARGQTSVP
GVFAAGDATTVPYKQIVIAMGEGSKAALSAFDYLIRMAPVEAVAAA
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
gtgttggatagcaacgtcaaaggccagctcaaggcctatttcgacaagatcacgcagccc
atcgaactggccgcctccctggacgacggcgccaagtcgcaggacatgcaggctctgctg
caggacatcgcgtccctgtcggacaagatcaccttcgtccgcaccgacgacgatgcgcgc
aagccctccttcgcgatcaagcgcaccggcaccgacatcggcgtccgcttcgccggcctg
ccgatgggccatgaattcaattccctcatcctcgccctgctgcaggttggtggccacccc
tccaaggagtcggcggaggtcatcgagcaggtgaaggcgctggagggtgagtaccgcttc
gagacctacttctcgctgtcctgccagaactgccccgacgtggtgcaggccctgaacctg
atgagtgtcctgaacccgcggatcaagcatgtcgccatcgacggcgcgctgttccagcag
gaggtcgactcgcgcaagatcatggccgtgccgtccatattcctgaacggcgagccgttc
ggccagggccgcatggggctggagcagatcctcgccaagatcgacaccggcgcctcgcag
cgcgacgcggagaagatcaaggccaaggacgccttcgacgtgctggtgatcggtggcggc
ccggccggcgccgcggcggcgatctacgcggcccgcaagggcatccgcaccggtgtggcg
gcggagcgcttcggcggtcaggtgctcgacaccatggccatcgagaacttcatctccgtc
tcccacaccgagggtccgaagctggccaccgcgctggagcagcacgtcaaggagtatgag
gtcgacgtgatgaacctgcagcgggcggacaagctgatccccgccgagggtccgggcggc
ctgatcgaggtccagctcgccaacggcgcctcgctgaagtccaagacggtgatcctgtcc
accggcgcccgctggcgccagatgggcgtccccggcgaggacgagtaccgcaacaagggc
gtggcctactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtcatc
ggcggcggcaactccggcgtggaagcggccatcgacctcgccggcattgtcgccgaggtg
acgctgatcgagttcgacagccagctccgtgccgacgaggtgctccagcgcaagctgcgc
agcctgcccaacgtgcgcgtcatcacctcgggcctgacgaccgaggtgcatggcgacggc
accaaggtgaccggcctcagctacaagaaccgcaacaccagtgaggtgcaccgcatcgac
ctggagggcatcttcgtgcagatcggcctcgtgcccaacacagaatggctgaagggcgct
gtggcgctgagcccgcgcggcgagatcgaggtggacgcccgcggccagacctccgtcccc
ggcgtgttcgcggcgggcgatgcgacgacggtgccctacaagcagatcgtcatcgccatg
ggcgagggctcgaaggcggccctatcggccttcgactacctgatccgcatggcgccggtc
gaggccgtcgccgcggcgtaa

DBGET integrated database retrieval system