KEGG   Azospirillum brasilense Sp7: AMK58_23345Help
Entry
AMK58_23345       CDS       T04566                                 

Definition
(GenBank) multidrug transporter
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
abf  Azospirillum brasilense Sp7
Brite
KEGG Orthology (KO) [BR:abf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:abf02000]
    AMK58_23345
Transporters [BR:abf02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   AMK58_23345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD_D23 HlyD_3 Biotin_lipoyl_2 HlyD Biotin_lipoyl
Motif
Other DBs
NCBI-ProteinID: ALJ38433
UniProt: A0A0P0F0X8
LinkDB All DBs
Position
ABSP7_p2:complement(438106..439218)
Genome map
AA seq 370 aa AA seqDB search
MDTLQDRGAVVAGTNVTGERSAVGAAAAPPRKRRTVGVLLCLGAVVVAAGGWNWARSNGG
TATDNAYVRGDVTSLAPKVAGYVTAVEVEDNQTVGAGDVLFRIDDRDYRARLAQAVANVE
AAQARLTNVDAETRLQHVLIRQAEAQRRSAMAEMTLAAKAYDRRRELIRGNAVSQAHLDE
SDAARLKAEAGLSAASATVEAQQQRIAVLAAQRDAAVAAVAQAQAARDLAQIDLESTVVR
APVAGAVGNRQVRVGRLVAPGASLLDIVPVDDVWVVANYKETQLEHIRPGQRARVSVDGY
PDGTLDGVVDSLAPGSGSAFSLLPADNATGNFVRVVQRVPVKIRLVGNPLPGRLVPGLSA
RVEITQGGDQ
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggacacgctccaggacaggggggccgtcgtcgccggcacaaacgtcactggcgaacgc
tccgcggtcggcgccgccgcggctccccccagaaaaagaaggacggtcggcgtgctgctg
tgcctcggcgccgtcgtggtcgcggcgggcgggtggaactgggcccgttcaaacggcggg
acggcgaccgacaacgcctatgtccgcggcgacgtgacctcgctcgccccgaaggtcgcc
ggttacgtcacggccgtcgaggttgaggacaaccagaccgtcggagccggcgacgtcctg
ttccggatcgacgatcgcgactaccgcgcgcggctggcccaagcggtggccaatgtcgag
gcggcccaggcccggcttacgaacgtcgatgcggagacccggctacagcacgtcctgatc
cggcaggctgaagcccagagacggtcggccatggccgagatgactctcgcggccaaggcc
tacgaccgccgccgtgaattgatccgcggcaacgccgtcagtcaagcccaccttgatgaa
agcgacgctgcgcgcttgaaggcggaggcgggcctgtcggccgcctcggcgacggtcgag
gcccagcagcaacgcatcgccgtccttgccgcgcaacgcgacgcggccgttgccgccgta
gcccaggctcaggccgcgcgcgacctcgcccagatcgatctcgagagcaccgtggtgcgc
gcgccggtcgccggcgccgtcggcaaccgccaggtccgcgtcggccgcctcgtcgcgccg
ggcgcttccctgctcgacatcgttccggtcgacgatgtgtgggtggtggcgaactataag
gaaacccagctcgaacacatccggcccggccaacgcgcccgcgtctccgtcgacggttat
ccggacgggacgctcgacggcgtggtcgacagccttgcgcccggcagcgggtccgccttc
agtctgctgcccgcggacaacgcgacggggaacttcgttcgcgtcgttcagcgcgtgccg
gtgaagatccggcttgtcggtaatccgttgcccggccgcctcgtgcccggcctgtcggcc
cgtgtcgagatcacccagggaggcgaccaatga

DBGET integrated database retrieval system