KEGG   Azospirillum brasilense Sp7: AMK58_23720Help
Entry
AMK58_23720       CDS       T04566                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
abf  Azospirillum brasilense Sp7
Pathway
abf00564  Glycerophospholipid metabolism
abf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AMK58_23720
Enzymes [BR:abf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AMK58_23720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_binding_3 FAD_oxidored Pyr_redox_2 NAD_binding_8 Pyr_redox 4HBT 3HCDH_N GIDA
Motif
Other DBs
NCBI-ProteinID: ALJ38493
UniProt: A0A0P0F5X8
LinkDB All DBs
Position
ABSP7_p2:complement(522423..523964)
Genome map
AA seq 513 aa AA seqDB search
MAGVYDLAIVGGGINGCGIARDAAGRGCSVYLCEQKDLASGTSSASTKLIHGGLRYLEYY
EFRLVREALREREVLWRMAPHIIWPLRFVLPHLPGLRPSWFLRLGLFLYDHLGGRERLPG
TRGLDLRSDPAGKPLKPGFGRAFEYSDCWVDDARLVVLNAQDAARMGAAIRTRTRFLSAV
REDGLWTVTVEDTRSGRRSSIRARALVNAAGPWVSEVMRQGARSTVDARIRLVQGSHIVV
PKLFDHDRCYIFQNADKRIVFAIPYERDFTLIGTTDNDYQGDPADVRASEAEIAYLCAAA
GDYFAKPVTPADVVWTYSGVRPLYDDGASTAQAATRDYVLALDAPGDGKAALLNIFGGKI
TTYRRLADAAIAKLAPFLPKLAPGASDWSSAGTLPGGDFPVDGVAALVAELRGRAPFLTQ
PHLERLARTYGTRARRILDSAARPEDLGRDFGGTLTEAEVRYLMTEEWAETAEDVLWRRT
KLGLRLDAAQVQALDAFMTEERSRRERASDAAE
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggccggggtctacgaccttgccatcgtcggcggcggtatcaacggctgtggcatcgcg
cgcgatgccgcgggtcgcggctgctccgtctatctgtgtgaacagaaggatctggcgtcg
ggcacgtcctcggcctcgacgaagctgatccacggcggcctgcgctacctggaatattac
gagttccggctggtccgcgaggcgctgcgcgagcgtgaggtgctgtggcgcatggcgccg
cacatcatctggccgttgcgcttcgtcctgccccacctgcccggcctgcggccctcctgg
ttcctgcggctgggcctgttcctctatgaccatctcggcgggcgggagagactgccgggc
acgcgcgggctcgatctgcgcagcgatccggcgggaaagccgctgaagccgggtttcggt
cgcgctttcgaatattcggattgctgggtcgatgacgcgcgtctggtggtcctgaacgcg
caggacgccgcccgcatgggtgctgcgatccgcacccgcacccgcttcctgagcgccgtc
cgagaggacgggctgtggaccgtgacggtggaggacacacgcagcggccggcgcagcagc
atccgcgcacgcgcgctggtcaacgccgccggcccctgggtgtcggaggtcatgcggcag
ggggcgcgctccacggttgacgcgcgcatccgtctggtccagggctcgcacatcgtggtg
ccgaagctgttcgaccacgaccgctgctacatcttccagaacgccgacaagcgcatcgtc
ttcgccatcccctacgagcgcgatttcaccctgatcggcaccaccgacaacgactaccag
ggtgatccggcggacgtccgcgcttcggaggcggagatcgcctatctctgcgccgccgca
ggcgactatttcgccaagccggtgacgcccgccgacgtggtgtggacctattccggcgtc
cgcccgctctacgacgacggcgcctccacggcgcaggcggcgacccgcgactatgtgctg
gcgctcgacgcgccgggcgacggcaaggcggcgctgctcaacatcttcggcggcaagatc
accacctaccgccgtctggccgacgcggccatcgccaagctggcgcccttcctgccgaag
ctcgcacccggagcgtcggactggagcagcgccggcaccctgccgggcggcgatttcccg
gtggacggcgtcgcggcgctggtcgccgaactgcgcgggcgggcgcccttcctgacgcag
ccgcatctggagcggctggcgcgcacctacggcacccgcgcccgccggattctcgacagc
gccgcacggccggaggatctgggccgcgacttcggcgggaccctgaccgaggccgaggtc
cgctatctgatgacggaggagtgggcggagaccgccgaggacgtgctgtggcgccggacc
aagctggggctgcggctggacgccgcccaggtgcaggcgctcgacgccttcatgaccgag
gagcgcagccggagggagagggcatccgacgctgccgaatag

DBGET integrated database retrieval system