KEGG   Azospirillum brasilense Sp7: AMK58_27060Help
Entry
AMK58_27060       CDS       T04566                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
abf  Azospirillum brasilense Sp7
Pathway
abf00620  Pyruvate metabolism
abf00680  Methane metabolism
abf00710  Carbon fixation in photosynthetic organisms
abf01100  Metabolic pathways
abf01120  Microbial metabolism in diverse environments
abf01200  Carbon metabolism
Module
abf_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:abf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AMK58_27060
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    AMK58_27060
   00680 Methane metabolism
    AMK58_27060
Enzymes [BR:abf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AMK58_27060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ALJ39136
UniProt: A0A0P0F751
LinkDB All DBs
Position
ABSP7_p3:482565..485372
Genome map
AA seq 935 aa AA seqDB search
MTTHAARHSTAPANDTETGTDDKDFPLREDIRLLGRLLGDTVREQEGDGVYGVIESVRQA
SVRFNRDDDDSARREMAEILNGLPRDTMMSVVRAFSYFLHLANIAEDQHHIRRTRDHAIA
GSPAREGTLPYALERLEAAGVAPDRLAGVLDIAQVSPVLTAHPTEVQRKSILALEHKVAS
LLDTRDRSRLTPEEAEANMDALQEAILTLWRTRMLRPQRLAVIDEVKNGISYYTDTFFSE
LPKLFCRFEDLLAKRFPEREWSLPPYFRIGSWIGGDRDGNPFVTAPILREAMRLQSTAAL
DHYLTEIHELGGELPLSELLLGTSPELEELAKRSPDHSPHRADEPFRRALTGIYARLAAT
SRTLDQHEALRNAVGKGDPYPTSAELLADLEVLAASLKAHGAGRLAAGRLRRLIIAVKTF
GFHLAPIDLRQNSDVHQRTVAELLAVAGRCADYAALSEDERIALLAEEIQSPRPLHSPYH
AYSEETAGELAIFFAARQLRETYGPAALPNSIISKTDGASDLLEVALLLKESGLLRPGAG
GEPGLGLNIVPLFETIEDLRQAPATMERLFTLPAYRALVTSRGDEQEVMLGYSDSNKDGG
FLTSGWELYKAEIELAKLFDRHGVRMRLFHGRGGSVGRGGGPSYQAILAQPTGAVSGQIR
ITEQGEVIASKYGRPEVGQRNLEVLTAATLEATLLDLENRVEPAESFYAAMERLSELAFG
AYRGLVYETPGFTQYFRTATPISEIATLNIGSRPASRTKSDRIEDLRAIPWVFSWAQCRL
MLPGWYGFGSAVEAWLKEEPDGLALLQRMNRAWPFFKSLLSNMDMVLAKSDLAIASRYAE
LVEDVELRERIFGRIREEWQRTRRHLLAIAGHDELLGENPLLARSIRNRFPYMDPLNHVQ
VELLRRHRAGSSDERVRRGILMSINGVAAGLRNSG
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccacgccgcccgccattccaccgctccggccaacgacactgaaaccggcacc
gacgacaaggatttcccgctgcgcgaggacatccgcctgctcggccgcctgctcggcgac
accgtgcgcgagcaggagggcgacggcgtctacggcgtcatcgagagcgtgcgccaggcc
tcggtccgcttcaaccgcgacgacgacgactccgcccgccgcgagatggccgagatcctg
aacggcctgccgcgcgacacgatgatgtcggtggtgcgcgccttttcctacttcctgcac
ctcgccaacatcgccgaggaccagcaccacatccggcgcacccgcgaccacgccatcgcc
ggctcgccggcgcgcgagggcacgctgccctacgcgctggagcggctggaggccgccggc
gtcgcgccggaccggctggccggcgtgctggacatcgcccaggtcagcccggtgctgacc
gcccacccgaccgaggtccagcgcaagagcatcctggcgctggagcacaaggtggcgtcc
ctgctcgacacccgcgaccgctcccgcctgacgccggaggaggcggaggccaacatggac
gcgctgcaggaggccatcctgaccctgtggcgcacccgcatgctgcgcccgcagcgcctc
gccgtgatcgacgaggtgaagaacggcatctcctattacaccgacaccttcttctccgag
ctgccgaagctgttctgccgcttcgaggatctgctggccaagcgcttccccgagcgggag
tggtcgctgccgccctatttccgcatcggttcctggatcggcggcgaccgcgacggcaac
ccgttcgtcacggcaccgatcctgcgcgaggcgatgcgcctgcaatcgaccgccgcgctc
gaccactatctgaccgagatccacgagctgggcggcgagctgccgctgtccgaactgctg
ctcggcacctcgccggagctggaggagctggccaagcgctcccccgaccattcgccgcac
cgcgccgacgagccgttccgccgcgccctgaccggcatctacgcccgcctggcggcgacc
tcgcgcacgctcgaccagcatgaggcgctgcgcaacgcggtcggcaagggcgatccctac
cccaccagcgccgagctgctcgccgatctggaggtgctggccgcctcgctgaaggcccac
ggggcgggccgtctggccgccgggcggctgcgccgcctgatcatcgcggtgaagaccttc
ggcttccatctggcgccgatcgacctgcgccagaactccgacgtgcaccagcgcacggtg
gcggagctgctggccgtcgccggccgctgcgccgactacgccgccctgtcggaggacgag
cgcatcgccctgctggccgaggaaatccagagcccgcgcccactccactcgccctaccac
gcctattcggaggagacggcgggcgagctggcgatcttcttcgccgcccgccagctgcgc
gagacctacggacccgccgccctgccgaacagcatcatctccaagacggacggcgcgtcc
gacctgctggaggtggcgcttcttctcaaggaatccggcctgctgcgcccgggtgcgggc
ggtgaaccgggcctcggcctcaacatcgtcccgctgttcgagaccatcgaggatctgcgg
caggccccggcgaccatggagcggctgttcaccctgcccgcctaccgcgccctggtcacc
tcgcgcggggatgagcaggaggtgatgctcggctattcggacagcaacaaggacggcggt
ttcctgacctccggctgggagctgtacaaggcggagatcgagctggcgaagctgttcgac
cggcacggcgtgcgcatgcggctgttccacggccgcggcggctcggtcggccgcggcggc
ggccccagctatcaggccatcctggcccagccgaccggcgcggtgtccggccagatccgc
atcaccgagcagggcgaggtcatcgcgtcgaagtacggccgccccgaggtcgggcagcgc
aacctggaggtcctgaccgcggcgacgctggaggccaccctgctcgacctggagaaccgc
gtcgagccggcggagtccttctacgcggcgatggagcggctgtcggagctggccttcggc
gcctaccgcgggctggtctacgagacgccgggcttcacccagtatttccgcacggccacg
ccgatctcggaaatcgccacgctgaacatcggcagccgcccggcctcgcgcaccaagtcg
gaccgcatcgaggacctgcgcgccattccctgggtcttctcctgggcgcagtgccgcctg
atgctgccgggctggtacggcttcggcagcgccgtggaggcgtggctgaaggaggagccg
gacgggctggccctgctccagcgcatgaaccgcgcctggcccttcttcaagtcgctgctg
tccaacatggacatggtgctggccaagagcgacctcgccatcgcctcgcgctacgcggag
ctggtggaggacgtcgagctgcgcgagcgcatcttcggccgcatccgcgaggagtggcag
cgcacccgccgccatctgctggccatcgccgggcatgacgagctgctgggcgagaatccg
ctgctggcacggtcgatccgcaaccgcttcccctacatggacccgctgaaccatgtgcag
gtcgagcttctgcgacgtcaccgcgccggcagcagcgacgagcgggtgcggcgcggcatc
ctgatgtcgatcaatggcgtcgccgccggcctgcgcaacagcggctga

DBGET integrated database retrieval system