KEGG   Asaia bogorensis: Asbog_00368Help
Entry
Asbog_00368       CDS       T04138                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
abg  Asaia bogorensis
Pathway
abg00020  Citrate cycle (TCA cycle)
abg00190  Oxidative phosphorylation
abg00650  Butanoate metabolism
abg01100  Metabolic pathways
abg01110  Biosynthesis of secondary metabolites
abg01120  Microbial metabolism in diverse environments
abg01130  Biosynthesis of antibiotics
abg01200  Carbon metabolism
Module
abg_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:abg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Asbog_00368 (sdhB)
   00650 Butanoate metabolism
    Asbog_00368 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Asbog_00368 (sdhB)
Enzymes [BR:abg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Asbog_00368 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     Asbog_00368 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_10 Fer2
Motif
Other DBs
NCBI-ProteinID: BAT18678
UniProt: A0A0P0YDN4
LinkDB All DBs
Position
complement(398632..399411)
Genome map
AA seq 259 aa AA seqDB search
MVELRLPKNSTTRPGKFYPAPAEAKRKATFQVYRWSPDDESNPSLDSYELDLDKVGPMVL
DALLYIKDHIDATLTFRRSCREGICGSCAMNIDGENTLACLKPISSIKGTVKINPLPHMP
VVKDLVPNLNGAYAQLESIQPWLKSDTPPPPDTERLQSVEEREKLDGMWECILCFCCSTS
CPSYWWNGDRYLGPATLLAANRWIMDSRDDHTGERLEALDDSMKLYGCRTIMNCTQTCPK
GLNPAKAIANIKKLQVERE
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggttgaactccgcctgcccaaaaacagcacgacccgccccggcaaattctatccggcg
cctgccgaagccaagcgcaaggccacgtttcaggtctatcgctggtcgcccgatgacgag
tccaatccgagcctcgacagctatgaactcgatctcgacaaggtcgggccgatggttctc
gatgccctgctctatatcaaggaccatatcgacgcgacgctgacctttcgccgctcctgc
cgcgaggggatctgcgggtcctgcgccatgaacatcgatggcgagaacacgctggcctgt
ctcaagcccatcagttcgatcaagggcacggtcaagatcaatccgctgccgcatatgcca
gtggtgaaggatctagtgcccaacctgaacggcgcttatgcccaacttgagtccattcag
ccctggctgaaaagcgacaccccgccgccgcctgataccgaacgcctgcaaagcgtggaa
gagcgcgaaaaactggatggcatgtgggaatgcatcctgtgcttctgctgcagcacgtcc
tgcccgtcctattggtggaatggcgaccgttatctcgggcccgccacgctgctggccgcc
aatcgctggatcatggacagccgcgacgaccatacgggcgagcgactggaagcgctggat
gattccatgaagctctatggctgccgcaccatcatgaactgcacccagacctgccccaag
ggtctgaacccggccaaggccatcgccaatatcaagaaattgcaggtcgagcgggaatag

DBGET integrated database retrieval system