KEGG   Asaia bogorensis: Asbog_00369Help
Entry
Asbog_00369       CDS       T04138                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
abg  Asaia bogorensis
Pathway
abg00020  Citrate cycle (TCA cycle)
abg00190  Oxidative phosphorylation
abg00650  Butanoate metabolism
abg01100  Metabolic pathways
abg01110  Biosynthesis of secondary metabolites
abg01120  Microbial metabolism in diverse environments
abg01130  Biosynthesis of antibiotics
abg01200  Carbon metabolism
Module
abg_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:abg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Asbog_00369 (sdhA)
   00650 Butanoate metabolism
    Asbog_00369 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    Asbog_00369 (sdhA)
Enzymes [BR:abg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     Asbog_00369 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     Asbog_00369 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 RepA_C
Motif
Other DBs
NCBI-ProteinID: BAT18679
UniProt: A0A0P0YDM2
LinkDB All DBs
Position
complement(399423..401225)
Genome map
AA seq 600 aa AA seqDB search
MSAESAKKYRIVDHAYDVVVVGAGGSGLRATLGMGAGGLRTACVTKVFPTRSHTVAAQGG
IGASLGNMSEDNWRWHMYDTVKGSDWLGDQDAIEFMCREAESAVMELEHFGVPFSRTEDG
KIYQRPFGGHMSEYGKAPVARACAAADRTGHAILHTLYQQCLKHRVDFYVEYYVLDLIMD
DEGVCRGIVAWCLDDGSIHRFSAKMVVLATGGYGRAFQSCTSAHSCTGDGGGLAMRAGVP
TQDMEFVQFHPTGIFPAGCLLTEGCRGEGGYLTNSEGERFMERYAPTAKDLASRDVVSRA
MTIEINEGRGCGPKKDHIMLHLEHLGPELLHQRLPGISETARIFAGVDVTKEPAPVLPTV
HYNMGGVPTNLHGEVLRPTKDNLEAVVPGLMAVGEAACVSVHGANRLGTNSLLDLIVFGR
AAGKRAAEIIDPSVPVPPLPKEAGEAILAKFDQIREASGKFTVAELRERLQRIMQSHAAV
FRNTKSLADGCEKIRELWKDAQHMGLADRSLIWNSDLMEALEFANLLANATVTIESAHAR
HETRGAHAHDDYPERDDEHWMKHTVSYLDKDGAVSLLYRPVRMQTLTNDVEVFPPKKRVY
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggaatccgccaagaaataccgtatcgtcgatcacgcctatgatgtcgtggtc
gtcggtgccgggggctcgggtctgcgcgccacgttgggtatgggcgccggaggcctgcgc
acggcctgcgttaccaaggttttccccacacgcagccataccgtggccgcccaaggtgga
attggtgcctcgctaggcaacatgtccgaggataactggcgctggcatatgtacgacacc
gtcaaggggtcggactggctgggcgatcaggacgccatcgagttcatgtgccgcgaggcc
gaaagcgccgtgatggagctggaacatttcggcgttcccttctcgcgcacggaagacggc
aagatctatcagcgtccgtttggcggccatatgagcgaatatggcaaggcccctgtggcc
cgcgcctgtgccgctgccgaccgtacgggccatgccatcctgcacacgctgtatcagcaa
tgcctcaagcatcgcgtcgatttctacgtcgagtattacgtgctcgacctgatcatggat
gatgagggcgtctgtcgcggcatcgtggcctggtgcctcgatgacggctccattcatcgc
ttcagcgccaagatggtcgtactcgcaaccggcggttacgggcgcgccttccagagctgc
acctcggcccattcctgcacgggtgatggtggcggtctggccatgcgcgccggtgtgccg
actcaggacatggaattcgtgcagtttcatcctaccggcattttcccggcgggctgtctg
ctcacggaaggctgtcgcggtgaaggcggttatctgaccaattccgagggcgagcgcttc
atggagcgctacgcgcccaccgccaaggatctggcctcgcgcgatgtcgtgtcacgcgcc
atgaccatcgagatcaatgaaggccgtggctgtggtcccaaaaaggaccatatcatgctg
catctggaacatctcggcccggaattgctgcaccagcgtctgcccggcatctctgaaacc
gcgcgcattttcgccggggtggacgtgaccaaggagcccgctccggtgctgcccacggtc
cattacaatatgggcggtgtaccgaccaatctgcacggcgaggtcctgcgccccaccaag
gacaatctcgaagctgtcgtgcccggactgatggcggtcggtgaggctgcctgcgtttcc
gtgcatggtgccaaccgtctggggacgaactccctgctcgatctgatcgtgttcggtcgt
gcggctggcaagcgtgctgccgagatcatcgatcccagcgtgccggtaccaccgctgccc
aaggaggcgggcgaggccattctggccaagttcgaccagatccgcgaggcttcaggcaag
ttcaccgtggcggaactgcgtgagcgccttcagcgcattatgcagagtcatgcggccgtg
ttccgcaatacgaaatccctcgctgacggatgcgagaaaatccgggagctttggaaagac
gcgcagcatatggggctggccgatcgctcgctgatctggaacagcgatctgatggaagcc
ctggaattcgcgaatttgctggccaacgcgacggtgaccatcgaaagtgcccatgcacgc
catgaaacgcgtggcgcccatgcccatgacgattatcccgagcgcgatgacgagcactgg
atgaaacataccgtctcctatctcgataaggatggtgcggtgagcctgctctaccggccg
gtgcggatgcagaccctgaccaatgatgtcgaggtcttcccgcccaagaaacgtgtttac
tga

DBGET integrated database retrieval system