KEGG   Asaia bogorensis: Asbog_00389Help
Entry
Asbog_00389       CDS       T04138                                 

Definition
(GenBank) major facilitator superfamily sugar transporter
Organism
abg  Asaia bogorensis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1 MFS_2 Cren7 NTPase_I-T
Motif
Other DBs
NCBI-ProteinID: BAT18699
UniProt: A0A0P0YDR5
LinkDB All DBs
Position
complement(424248..425699)
Genome map
AA seq 483 aa AA seqDB search
MMTDSHDAQPPSHPETVEVALRRLEKAPDQRDHAHRMVALAAAIAAIGGLLFGYDTGIIA
SALIYITHSFSLDSTGQQGIAAALNLGAVFGAVMSGPLSDRIGRRSSVVSAALVFILASL
GCALSPDETWLIVARFALGWAIGATTQIVPVYVAELAPAERRGGLVSLFQLVFSLGLLVA
FFTGYFLAGPADCWRLMFGLGVIPAILLALGMMFLPESPRWLLEHGREAQAVAVLYRLRG
HHEPIRQELDALRDAQSKSADIPGWSALRARWLRPALIAAIGLAALSQLSGPNVIVYYAP
IILSEAGLGHAASLLTSVGVGVTSTITTLMGIMLIDRVGRRRMLLVMLPFAALALFGLGA
LFLDHAPLGGTRLVLVIIALLAYIFFNFGSLSVAVWLIASEVFPLIIRSKAMGLASATVW
LSDTLVSLFTLSLVHDLGRSGTFWLFGAINALAFLFVLRFVPETKGTTLEAIETRLREGH
FRP
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgatgactgactcacatgacgcgcagccgccatcgcaccccgagactgtcgaagtggcc
ctgcggcgccttgaaaaagcgcccgaccagcgtgaccacgcgcatcgtatggtggccctt
gcagcagccattgctgccattggcggactgcttttcggctacgataccggcatcatcgcc
tcagcgctgatctatattacccatagtttcagcctcgacagcacgggacaacagggcatc
gccgctgcactcaatctgggtgccgtgttcggggcagtcatgagcggcccgctctcagac
aggatcggccgtcgctcttcggtggtaagtgccgcactggtctttatccttgcctcgctg
ggctgtgcgctctcaccggatgaaacatggctgattgtcgcgcgcttcgcgctgggctgg
gctataggcgccacaacacagatcgtccccgtctatgtggctgaactggccccggcagag
cgtcgtggcgggctggtttcactcttccagctcgttttctcgcttgggctgctcgtcgca
ttcttcacagggtattttctcgccgggcctgccgattgctggcgcctgatgttcgggctt
ggtgtcatcccggcgatcttgctggctctgggcatgatgtttctgcccgaaagcccgcgc
tggctgctcgaacatgggcgcgaggcgcaggctgtggccgtgctgtatcgcctgcgcggt
catcacgaacccatccgtcaggagcttgacgccttgcgtgatgcacagtcgaaatccgcc
gacatacccggctggtcggccctgcgtgcacgctggctccgcccagcgctgattgctgct
atcgggcttgctgcgctgtcacagctttcgggcccgaatgtgattgtctattatgcgccc
atcattctttccgaggccgggctgggccatgcggcctcgcttcttacctcggtgggcgtg
ggggtcacatcgacaataaccaccctcatggggatcatgctgatcgaccgcgtcggccga
cgacgcatgctgctggtcatgcttcctttcgctgccctcgccctgttcgggcttggggcc
ttgtttcttgaccacgcgcccctcggtggaacgcggctcgtcctcgtcattattgcgttg
ctggcctatatcttcttcaatttcggctcgctctcggttgcggtgtggctgattgcctcc
gaggtttttccgctgatcatacgcagcaaggctatggggctcgccagcgccacggtctgg
ctgtctgacacgctggtctcgctgttcaccctgtcactggttcatgatttggggcggagt
ggcacattctggcttttcggcgccatcaacgccctcgcttttctgttcgtcctgcgcttt
gtgcccgagacgaaaggcaccacgctcgaagctatcgagacccgtttgcgtgaggggcat
ttccgcccctga

DBGET integrated database retrieval system