KEGG   Asaia bogorensis: Asbog_00439Help
Entry
Asbog_00439       CDS       T04138                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
abg  Asaia bogorensis
Pathway
abg00010  Glycolysis / Gluconeogenesis
abg00052  Galactose metabolism
abg01100  Metabolic pathways
abg01110  Biosynthesis of secondary metabolites
abg01120  Microbial metabolism in diverse environments
abg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:abg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Asbog_00439
   00052 Galactose metabolism
    Asbog_00439
Enzymes [BR:abg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Asbog_00439
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: BAT18748
UniProt: A0A0P0YDT0
LinkDB All DBs
Position
complement(479112..480368)
Genome map
AA seq 418 aa AA seqDB search
MCSPVTNKTPTDKSDTSNRDEAPGTSRTGRTTRPIMALASGSLAAALSLASAHAATMSAS
PFGTTQAGQKVEAYTLSAPNGVEVTIMTYGGVILRIMAPDRQGKRDNVVLGYASLAEYEA
KSRANGVFFGATIGRYANRIAKGRFTLDGHDYAVPVNNGPNSLHGGKDGFDRRIWKAHEI
ARSGNKVGVALSLISPDGDQGYPGALNVTVTYTLDDQGALGIEYKATTSRPTVLNLTNHS
YFNLAGAGSQDGIFGQMLQIEAHHYTPTDSTLIPTGEIASVVGTPFDFTTAKPIGRDIRL
ANAQLLMAHGYDHNWVVDDSSSPDGLRHVATLWDPKSGRSMECLSTEPGVQVYTSNFLDG
SDSGNGHIFRQSDAVTFETQHFPDSPNQPNFPSTRLNPGQVFQSRTVFRFGLHESDGK
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtgcagtccagtgacaaacaagacgccgaccgacaagagcgatacctcaaaccgcgat
gaggcgcccggaacatcgcgcaccgggcgaacgacgcggccgatcatggctcttgcctca
ggcagtcttgccgctgccctctcgctggcttcagcccacgccgcaaccatgagcgcgtca
ccatttggtacgacgcaggccgggcaaaaggtcgaagcctataccttgagcgcccctaac
ggcgtggaagtgaccatcatgacttatggtggagtcattttgcgcatcatggcccctgat
cgtcagggcaaacgcgacaacgtggtgctcggctatgcgtcgctcgccgaatatgaggcc
aaaagccgggccaatggggtgttcttcggcgcgacaatcggacggtatgccaatcgcatt
gcgaaaggtcgctttacactcgatggtcatgattacgcagtgccggtcaataacggcccg
aactcactgcatggcggcaaggacggcttcgaccggcgtatctggaaagcccatgagatc
gcccgctctggcaataaggtaggcgttgccctctccctgatcagcccggacggtgatcag
ggttatcccggtgcgctgaatgtgacggtcacctacacgctcgacgatcagggcgcgctg
ggtatcgaatacaaagcgaccacatccaggcctaccgtgctcaacctgaccaatcactcc
tacttcaacctcgccggggcaggatcgcaggacggtattttcggccagatgctgcagatc
gaagcgcatcattataccccgacagattcgactctcattccgacgggcgaaattgcttcc
gtcgtcgggacacctttcgatttcaccacagcaaagccaatcgggcgcgacatacgcctc
gccaatgcacagctgctcatggcacatggctatgaccataactgggtggttgatgactct
tcatcaccagacggcctcagacacgtcgccacgctctgggacccgaaaagcggtcgcagc
atggagtgcctgagcaccgaaccgggtgtgcaggtctatacctccaattttcttgacggc
tcggactcaggaaacggccatatctttcgccagagcgacgctgtgacctttgaaacccag
cattttcccgacagtcccaatcagccgaatttcccctcgacacgcctgaacccggggcag
gtttttcaaagccgtacggtcttccgcttcggcctgcatgaaagtgatgggaagtga

DBGET integrated database retrieval system