KEGG   Asaia bogorensis: Asbog_00667Help
Entry
Asbog_00667       CDS       T04138                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
abg  Asaia bogorensis
Brite
KEGG Orthology (KO) [BR:abg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Asbog_00667 (ahpF)
Enzymes [BR:abg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Asbog_00667 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 Glutaredoxin FAD_oxidored DAO FAD_binding_2 Thi4 HI0933_like FAD_binding_3 NAD_binding_8 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: BAT18963
UniProt: A0A0P0YEF1
LinkDB All DBs
Position
736369..737928
Genome map
AA seq 519 aa AA seqDB search
MLQDPIKSQLSTYLANLGHPVVLEASLDGSAKAREMGELLQEVAALSDKVTYSEDGVSER
RPSFLIRRGDSRHGVNFAAIPMGHEFTSFVLALLQAGGHPPKIEPAIAEQIKGLAGEFRF
EIFVSLSCQNCPDVVQALNAMSVINPAINVTTIDGALFQEEVASKNIMTVPQVYLNGMAF
GSGRMDVNQILAKLDDDAPRRAAERLKDMPAFDVLIIGSGPAGASAAIYAARKGLRTGLV
ADRFGGQVMDTAGIENFISIKETEGPKLSAQLEAHVRSYDVEIISGQRAKELFPAARPGG
LHGIALESGAILHSRTVILTTGAHWRQLGVPGEEQYRTKGVAYCPHCDGPFYKGKRVAVA
GGGNSGVEAAIDLAGIVGHVTLLQRSSKLKADKVLQDKLRSLPNVTVLTEALTSRIEGDG
NKVNGLTYRGGDGKDHRIELEGVFVQIGLLPNTEWLRNTLALNDFGEIKVDDHGATSVPG
VFAAGDATTTPYKQIVIAVGEGAKSALSAFDYLIRLPAE
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgttgcaggaccccatcaagtcacagctttcgacctatctcgccaatctgggccacccg
gtcgtgcttgaagcgtccctcgacgggagcgcgaaagcgcgggagatgggtgaactcctt
caggaagttgctgccctttccgataaagtgacctattcggaagacggtgtcagcgagcgt
cgtccgtccttcctgatccgtcgtggcgacagccgacatggcgtgaattttgcggccatc
ccgatggggcatgaattcacttccttcgtgctggcattgcttcaggcgggtggccatccg
cccaagatcgagccggcaattgccgagcagatcaaggggcttgcaggcgagttccgcttc
gagatcttcgtctcgctctcgtgccagaactgccctgatgtggtgcaggccctgaacgcc
atgagcgtgatcaacccggccatcaacgtcacgaccatcgacggtgccctgttccaggag
gaagtggcatcgaagaacatcatgactgtgccgcaggtctatctgaatggcatggccttc
ggctctggccgcatggatgtgaaccagatccttgccaagctggatgacgacgccccgcgt
cgtgcggcagagcgtctgaaggacatgcccgccttcgatgtgctgatcatcggcagcggc
cctgccggcgcctccgccgccatttacgcggcacgcaagggactgcgaacggggcttgtg
gctgaccgcttcggtggtcaggtcatggacacggccggaatcgagaacttcatctcgatc
aaggaaaccgagggacccaagctctccgcccaactcgaagcccatgtgcgcagctatgat
gtggagatcatctccggtcagcgtgccaaggaactcttccccgctgcgcgaccgggtggg
cttcatggcatcgcgcttgagagcggtgcgatcctgcacagccgcacggtcattctgacc
acaggggctcactggcgtcagctgggtgtgccgggtgaggagcagtatcgcaccaagggt
gtggcctattgcccgcattgcgatggcccgttctacaagggcaagcgtgttgccgtggct
ggcggcggcaatagtggtgtcgaggcggccatcgatctggcgggtatcgtcggtcatgtc
acgttgttgcagcgcagctccaagctcaaggccgacaaggtgttgcaggacaagctgcgc
agcctgcccaatgtgacggttctgaccgaggcgctgacgagccgcattgagggtgacggt
aacaaggtgaacggcctgacctatcgcggtggcgatggcaaggaccacaggatcgagctg
gaaggcgtgttcgtccagatcgggctgctgcccaatactgagtggctgcgcaatacgctg
gcactgaacgatttcggcgagatcaaggtcgatgatcacggcgcaacctctgttccgggc
gtatttgccgcaggcgatgcgacgacgacgccctacaagcagatcgtgattgccgtgggc
gagggagcgaagagcgccctttccgccttcgactatctgatccgtctgcctgccgagtaa

DBGET integrated database retrieval system