KEGG   Asaia bogorensis: Asbog_02164Help
Entry
Asbog_02164       CDS       T04138                                 

Definition
(GenBank) alcohol dehydrogenase Zn-dependent
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
abg  Asaia bogorensis
Brite
KEGG Orthology (KO) [BR:abg00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Asbog_02164
Enzymes [BR:abg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     Asbog_02164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: BAT20420
UniProt: A0A0P0YI56
LinkDB All DBs
Position
complement(2424091..2425218)
Genome map
AA seq 375 aa AA seqDB search
MNKIVTPDLGALQKEAASVALPEKMMAVVAYEPGDYRWEEVDVPRAGPDDIIIEVETVGI
CAGDIKCFLGAPSFWGDKEQPRYVKPPMIPGHEFIGRAVEIGENLRGQYKVGDRLISEQI
VPCDDCRYCKGGQYWMCERHDLYGFQNNTNGAMAKYMRFPKTSRTHRVPEDMPAEAAALI
EPYACSVHAVNRANIQLDDVVVLAGAGTLGLGMVGAARLKNPSKLIVLDTKQDRLDLAKK
FGADIVMNPLEEDVVAKVKELTGGYGCDVYIEATGHPSSVRQGLHMIRKLGRFVEFSVFG
DEVTCDWSIISDRKELDVLGAHLGPYCYPFTIAAIADGRLPVEGVVTHSLPLDQWKEGFD
LMKKGDKSIKTVLIP
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagattgttacgcctgacctgggtgccctgcagaaagaagcagccagcgtcgcc
ctgccggaaaagatgatggccgtcgtcgcctacgaacccggcgattatcgctgggaagag
gtggatgtcccccgcgccggtcccgatgacatcatcatcgaagtcgagaccgttggcatc
tgcgccggtgacatcaagtgcttcctgggcgccccttccttctggggcgacaaggaacag
ccccgctacgtcaagccgccgatgatcccgggccacgaattcatcgggcgcgctgtcgag
atcggcgagaacctgcgcgggcagtacaaggtgggtgaccgcctgatcagcgagcagatc
gttccctgcgacgattgccgctactgcaagggcggtcagtactggatgtgcgagcgtcac
gacctgtacggcttccagaacaacaccaacggcgccatggcgaagtacatgcgcttcccc
aagacgtcgcgcacccatcgtgttcccgaggacatgcctgccgaggcggctgccctgatc
gagccctatgcctgctccgttcacgctgtgaaccgtgcgaacatccagcttgatgacgtg
gtggttctggcgggtgccggtacgctgggtctgggcatggtgggcgctgcccgcctgaag
aacccgagcaagctgatcgtgctcgacaccaagcaggaccgtctggatctggccaagaag
ttcggcgcggatatcgtgatgaacccgcttgaagaagacgtggtggccaaggtcaaggaa
ctgaccggtggctatggctgcgatgtgtatatcgaagcaaccggccatccctcgagcgtt
cgtcagggcctgcacatgatccgcaagctcggccgcttcgtcgagttcagcgtgttcggc
gatgaagtgacctgcgactggtcgatcatttccgaccgtaaggagctggacgtgctcggt
gcgcatctgggtccgtactgctaccccttcaccattgccgccattgccgatggtcgtctg
ccggtcgagggtgtggtgacccactccctgccgctggaccagtggaaggaaggcttcgac
ctgatgaagaagggcgacaagtccatcaagacggtcctgatcccataa

DBGET integrated database retrieval system