KEGG   Asaia bogorensis: Asbog_02193Help
Entry
Asbog_02193       CDS       T04138                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
abg  Asaia bogorensis
Pathway
abg00040  Pentose and glucuronate interconversions
abg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:abg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Asbog_02193
Enzymes [BR:abg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     Asbog_02193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: BAT20449
UniProt: A0A0P0YID0
LinkDB All DBs
Position
complement(2458664..2459701)
Genome map
AA seq 345 aa AA seqDB search
MAQALVLEERSKLSLRDIALDDTLGPDDVRIAIHTVGICGSDVHYYTHGAIGPFIVREPM
VLGHEASGTITALGSRVSGLKIGDRVCMEPGIPDPQSRASRLGQYNIDPAVRFWATPPVH
GCLTASVVHPAAYTYKLPDRVSFAEGAMVEPLAVGVHACVKARLQPGDVCLVTGAGPIGI
MTALAALASGASQVFISDFSAPKLTIAGAYPNIVPINLAEGKAAERIALHCGEGWGVDVT
FEASGFESAYDDAIACTRPGGRLVLVGMPPRKVAFDIVAAQAKELSMETIFRYAHVYDRA
IALIASGSIDLKPLVSGTYPFGDAIAAFERAAEGRAEDVKLQITL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggcactggttctggaagagcgtagcaaactgtcgctgcgggacattgcccta
gatgacacgcttggccctgatgatgtgcgtattgccatccatacggtcgggatctgcggg
agcgatgtgcattactatacgcatggtgccatcgggccgtttatcgtgcgcgagcccatg
gtgctcgggcatgaggcctcggggaccatcaccgcgctgggcagccgcgtctcggggctg
aaaatcggtgaccgtgtgtgcatggagccgggcattcctgacccgcaatcgcgtgcctcc
cgtctggggcagtataatatcgaccctgcagtgcgcttctgggcaaccccgcctgtgcat
ggttgcctgaccgcctctgtcgtgcatccggcggcttacacgtacaaattgcctgatcgt
gtgagctttgctgaaggggcgatggtcgagccgctggcggtcggggttcatgcctgcgtc
aaggcgcgcctgcagcccggcgacgtctgtcttgttacaggagcagggccgatcgggatc
atgacagcgcttgcggcgctggcctccggggcaagccaggttttcatcagcgatttctcg
gcccccaaactcactatcgccggggcttatcccaatattgtgccgatcaatctggcagaa
gggaaagcagcagagcgcattgccttgcattgcggcgagggctggggggttgatgtcacg
ttcgaggcgagcggtttcgaaagcgcctatgacgatgcgatagcctgcacgcgccccggt
ggccgtctcgttctggtcggcatgccgccgcgcaaggtcgctttcgatatcgtggcggct
caggcgaaggagctgagcatggagacgatcttccgctatgcccatgtctatgatcgcgcg
attgccctgattgcctcgggcagtatcgaccttaagccgcttgtctccggtacttatccc
ttcggtgacgccatcgccgcctttgagcgtgcggcagaggggcgcgccgaggatgtcaaa
ttgcagatcacgctctga

DBGET integrated database retrieval system