KEGG   Acinetobacter baumannii TYTH-1: M3Q_192Help
Entry
M3Q_192           CDS       T02261                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
abh00620  Pyruvate metabolism
abh00680  Methane metabolism
abh01100  Metabolic pathways
abh01120  Microbial metabolism in diverse environments
abh01200  Carbon metabolism
Module
abh_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:abh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    M3Q_192
  09102 Energy metabolism
   00680 Methane metabolism
    M3Q_192
Enzymes [BR:abh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     M3Q_192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AFU36288
LinkDB All DBs
Position
205129..207813
Genome map
AA seq 894 aa AA seqDB search
MVQQIDAPLREDVRLLGNLLGETLKQHAGQELFNQIEQIRALAKGARDGQAEAEKQLEQL
FLELPDEELLPLTRAFSHFLNFANIAEQYHVVRSRRQAEFDPDANSPNPLVHLFKKFKDK
NISTEKLFQQICDLKIELVLTAHPTEVSRRTLIQKYDDINACLSQLDQQKLTPRERQNAL
ANLKQQISSAWQTDEIRQHRPTPVDEAKWGFATIEQTLWNAVPKFIRELNELVQDNCQQN
LPLHIAPVRFASWMGGDRDGNPNVTHQITQEVLWLSRWQAADLYLRDIENLRWELSIQSC
SEEMVQAIGSPHPEPYREYLRATRERLKATRHWLAQRLQGLEADDSNVIKSKDELLQPLL
LCYRSLIDSNLPEIANGQLLDFIYRVNCFGIELLKLDIRQESGRHRQAISAITEYLGLGN
FESWTEQARQNFLIQELQSKRPLLPKYINEPEGSLIGHPDVQEVFATMRTLADQPPESLG
AYIISMAEYPSDVLAVLLLQKEAGIQHPLRVVPLFETLKDLDGAATTMNTLFNMHWYKQH
IQGKHEVMIGYSDSAKDAGFMSANWAQYRAQEELTAIARKHGVQLTLFHGRGGSISRGGA
PTQQALFSQPPGSISGAIRVTEQGEMIRFKFGLEGIAMQNLEIYTAATLEATLLPPPEPK
AEWRELMNRMTDHSVKVYRQTVRENPHFVKYLRTVTPELELQMLPLGSRPAKRKVSGGIE
SLRAIPWVFAWTQIRLMLPAWLGTGAAINEVIADQQKATLDEMLQQWPYFQTLIDMLEMV
LSKADANIALYYESHLTEDEDLKVLGNQLRQRLKDAVETLLALKDESKLLSDNEVLDQSM
QVRKPYLLPLHLLQAELMKRRRDYLAERQAEHTPVDHALMVSIAGIAAGLRNTG
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atggttcagcaaatcgatgcgccactgcgtgaggatgtccgcttacttggcaatttatta
ggtgaaaccctaaaacagcatgcaggacaagaactgtttaatcagatcgagcaaatccgt
gctcttgccaaaggtgcacgtgatggtcaagctgaagccgaaaagcaattagaacaatta
tttttagaattgcccgatgaagagctattgcctcttacccgcgctttttctcacttcctc
aattttgccaatattgctgagcaatatcatgtggtacgtagccgcagacaggcagagttt
gatccggatgcaaactccccgaatccccttgttcacttatttaaaaagtttaaagataaa
aatatttcgacagaaaaactgttccagcaaatttgtgatcttaagattgaattggtactt
acggcgcatccaacagaagtgagtcgtcgtaccctgattcaaaaatatgacgatatcaat
gcttgtctatcacaacttgatcagcaaaaacttactccgcgtgaacgacaaaatgctctt
gccaatttaaaacaacaaattagttcggcttggcaaacagatgaaatcaggcagcaccgc
ccgaccccggtagatgaagcaaaatgggggtttgccacaattgagcaaacgctttggaat
gctgttcctaaatttatccgtgagctaaatgaactggttcaagacaattgccaacaaaac
ttaccacttcatattgctccggtacgttttgcatcttggatgggtggagaccgtgatggt
aacccgaacgttactcatcaaattacccaagaagtattgtggttatcacgctggcaagct
gccgacctctatctaagagatatcgaaaacttacgttgggaactatcaattcagtcttgt
tccgaagaaatggttcaagccattggtagtccacacccagaaccttatcgtgagtattta
cgtgcaacacgagagcgtttaaaagcaactcgtcattggttagctcagcgcctacaaggc
ttagaagctgatgacagcaatgtcattaaaagcaaagatgaactgttacaaccattattg
ctgtgctatcgctctctaattgacagtaatctacctgaaatcgcgaatggtcaactactc
gactttatctaccgtgtgaactgttttggtattgaactacttaagctcgatattcgccaa
gaatcaggccgtcatcgccaagccatttcagcaattaccgaatacttaggtctgggtaat
tttgagtcatggactgaacaagcgcgccaaaacttccttatccaggaactccaaagcaaa
cgcccgctactaccgaagtatattaatgagccagaaggtagtttgattggtcacccagat
gtacaagaagtatttgcaaccatgcgtactttggcagaccagccacctgagtctttaggg
gcttatattatttctatggctgaatatccaagtgatgttttagctgtattgttattgcaa
aaagaagccggtattcagcatcctttacgtgtagtgcctttatttgagactttaaaagac
ttagacggcgcagcaactaccatgaatactttgtttaatatgcattggtataagcagcat
attcagggtaaacacgaagtcatgatcggctactcggactcagcaaaagatgctggcttc
atgtctgctaactgggcccaataccgtgctcaagaagagctgactgcaattgcccgtaaa
cacggcgtacagttgactctgttccacggtcgtggcggctcaattagccgtggtggtgct
ccaacgcaacaagcactcttttcgcaaccaccgggctcaatctctggtgcaattcgtgtg
acagaacaaggtgaaatgatccgcttcaaattcggtctagaaggtattgccatgcaaaac
cttgaaatctataccgcagcaacgcttgaagcgacattattaccaccaccagagcctaag
gctgagtggcgtgaacttatgaaccgtatgacagatcattctgtgaaggtttatcgtcaa
acagtgcgtgaaaacccgcattttgtgaagtacttacggactgtcactcctgagcttgaa
ttacaaatgttgccgctaggctcacgtccggcaaaacgtaaagtaagtggcggtatcgag
tctttacgtgccattccatgggtgtttgcttggacacaaatccgtttgatgttacctgca
tggttaggtacaggtgcggcgattaatgaagtgattgctgatcagcaaaaagcaacgctt
gatgaaatgcttcagcaatggccttatttccagacactcattgatatgctggaaatggta
ttgtctaaagccgatgccaatattgcactctactacgagtctcatttgactgaagatgaa
gacttaaaagtgctgggcaatcagttacgccaacgtctaaaagatgctgtggaaaccttg
cttgcgttaaaagatgaatcaaaactattaagcgacaatgaagttttggatcagtctatg
caagttcgtaaaccgtatttactgcctttgcatcttttacaagctgaactcatgaaacgc
cgccgtgattatcttgctgaacgtcaggcagagcatacccctgttgaccatgcacttatg
gtaagtattgccggaattgctgctggtttacgtaatacaggctaa

DBGET integrated database retrieval system