KEGG   Acinetobacter baumannii TYTH-1: M3Q_3145Help
Entry
M3Q_3145          CDS       T02261                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
abh00564  Glycerophospholipid metabolism
abh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:abh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    M3Q_3145
Enzymes [BR:abh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     M3Q_3145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 3HCDH_N FAD_binding_2 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AFU39232
LinkDB All DBs
Position
complement(3358037..3359554)
Genome map
AA seq 505 aa AA seqDB search
MKVQPNDYSKIYDLAVIGGGINGVGIANDAAGRGLSVFLCEKDDLASHTSSASSKLIHGG
LRYLEHKEFRLVREALAEREVLLAKAPHIIKPMRFIMPHRPHLRPAWLIRAGLFFYDHLG
KREKLLGSNLIYFKEDSPLKPAITRGFEYSDCTVDDARLVVLNALQAKEKGAKVVTRTRC
VKAYRQQELWHLELQSGAEFYQIRAKAIVNAAGPWVEEIISENLSLSSPYQIRLIQGSHI
VVPKLYDCHKAFIMQNEDRRIVFAIPYLEKYTLIGTTDQEYTGDPQKVEITDVEIDYLLT
VTNSHFKKQLTRADIVSQYSGVRALCDDESDNPSAITRDYTLALQAEDKTTPLLSVFGGK
ITTYRKLAEAALEHLAPFFNDMAEEWTADEPLPGAENWTTLDDLINQIKTRVSGISDSLA
NRWAHAYGTRVWNMLKERNAIEQLGQHFGHDLFECEVRYLCEYEWAHTAEDILWRRSKLG
LAFDEKQVKVLEAYLSERRLKDDAA
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtacaacctaatgattattcaaaaatatatgatcttgccgtaattggcggtggt
attaatggtgttggtattgccaatgatgcagcagggcgcggattatcggtatttttatgt
gaaaaagatgatttagccagccatacctcatctgctagcagcaaattaattcatggcggc
ctacgttatttagaacataaagaattcaggctggtcagagaagcattagcagagcgtgaa
gtattgctagctaaagcgccacatattattaaaccaatgcgttttatcatgcctcatcga
ccccatttacgccctgcatggctaattcgagcaggtctatttttttatgatcatttggga
aaacgagaaaaattattaggatcaaatctcatttatttcaaagaagatagccctttaaaa
ccagcgataacacgtggttttgaatattctgactgtactgtagatgatgcgcgtcttgtg
gtattaaatgcactacaagctaaagagaaaggggcgaaagtcgttacacgtacgcgttgt
gttaaggcttataggcaacaggaattgtggcatctggagttacaaagcggagctgagttc
tatcagatacgtgcgaaagctattgtaaatgcggcgggaccttgggttgaagaaattatt
agtgaaaacctgagtttaagttcaccttatcaaattaggcttatacaaggaagtcatatt
gttgtgccaaaattatatgactgccataaggcctttattatgcaaaacgaagatcgaagg
atcgtttttgcaattccttatttagaaaaatataccctcattggtacaacagatcaggaa
tacacaggtgatccacaaaaagtagagattactgatgtggaaatcgattaccttttgaca
gtgacaaattcacattttaaaaagcagttgacgcgagctgatattgtaagtcagtactcg
ggtgtgcgtgctttatgtgatgatgagtctgataatccatctgcaattacacgcgattat
actttggctctacaggcagaagataaaactacaccattgctctcagtgtttgggggcaag
attacaacttaccgaaagttagccgaagctgctttagagcatctggctccgttttttaat
gacatggcagaggagtggactgcagatgagccattacctggcgccgaaaactggaccaca
ctagatgatttaatcaatcagattaaaacacgtgtaagtggaatttctgactcacttgcc
aaccgttgggctcatgcatatggcacaagagtgtggaatatgcttaaagagcgaaatgct
atagaacaattgggtcaacattttggccatgatttgtttgagtgtgaagtcagatatttg
tgtgaatatgaatgggctcacacagcagaagatatactttggcgcagatctaaattaggt
ttggcatttgatgaaaaacaggtaaaagttttagaagcttatttatctgaacgtcgatta
aaagacgatgccgcataa

DBGET integrated database retrieval system