KEGG   Acinetobacter baumannii TYTH-1: M3Q_3189Help
Entry
M3Q_3189          CDS       T02261                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
abh00020  Citrate cycle (TCA cycle)
abh00190  Oxidative phosphorylation
abh00650  Butanoate metabolism
abh01100  Metabolic pathways
abh01110  Biosynthesis of secondary metabolites
abh01120  Microbial metabolism in diverse environments
abh01130  Biosynthesis of antibiotics
abh01200  Carbon metabolism
Module
abh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
abh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:abh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    M3Q_3189
   00650 Butanoate metabolism
    M3Q_3189
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    M3Q_3189
Enzymes [BR:abh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     M3Q_3189
    1.3.5.4  fumarate reductase (quinol)
     M3Q_3189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: AFU39276
LinkDB All DBs
Position
complement(3412733..3413443)
Genome map
AA seq 236 aa AA seqDB search
MSRGTRTFEIYRYDPDKDKAPYMQTFKLELTDKHRMLLDALLALKVQDETLTFRRSCREG
ICGSDGVNINGKNGLACLQNLNDLPEKIVIRPLPGLPVVKDLVVDMNQFYDQYDKIQPFL
INNQPAPPKERLQSPEEREHLNGLYECILCACCSTSCPSFWWNPDKFLGPSALLNAYRFI
IDSRDTATAERLARLDDPFSLFRCKGIMNCVSVCPKGLNPTKAIGHIRNMLLDQAG
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgagtagaggtactcgtacattcgaaatctaccgctatgatcctgataaggataaagcg
ccgtacatgcaaactttcaagcttgaattgactgataagcaccgtatgttgcttgatgca
ttgcttgctttgaaggttcaagacgaaacgttaacattccgtcgttcttgccgtgaaggt
atttgtggttctgatggtgtgaatatcaatggtaaaaatggtttggcttgcttgcaaaac
cttaacgatttaccagagaaaatcgtaattcgtccattacctggtttgccggttgttaaa
gatttggttgttgatatgaaccaattctatgatcagtatgacaaaattcagccattcttg
attaataaccaacctgctccacctaaagagcgtttgcaatctcctgaagagcgtgaacac
ttaaatggtttgtatgagtgtattctttgtgcatgttgttcaacttcatgcccatcattc
tggtggaaccctgataaattcttgggtccttcagcgttgttgaatgcatatcgttttatt
atcgactctcgtgatactgcaactgcagaacgtttggctcgtcttgacgatccgttcagt
ttgttccgttgtaaaggtattatgaactgtgtgtcagtatgtcctaaaggtttgaatcca
acaaaagcaatcggtcatatccgtaatatgttgttagatcaagcgggttaa

DBGET integrated database retrieval system