KEGG   Acinetobacter baumannii TYTH-1: M3Q_3190Help
Entry
M3Q_3190          CDS       T02261                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
abh00020  Citrate cycle (TCA cycle)
abh00190  Oxidative phosphorylation
abh00650  Butanoate metabolism
abh01100  Metabolic pathways
abh01110  Biosynthesis of secondary metabolites
abh01120  Microbial metabolism in diverse environments
abh01130  Biosynthesis of antibiotics
abh01200  Carbon metabolism
Module
abh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
abh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
abh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:abh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    M3Q_3190
   00650 Butanoate metabolism
    M3Q_3190
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    M3Q_3190
Enzymes [BR:abh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     M3Q_3190
    1.3.5.4  fumarate reductase (quinol)
     M3Q_3190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Thi4 Pyr_redox_2 GIDA HI0933_like FAD_binding_3 NAD_binding_8 Pyr_redox_3 NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AFU39277
LinkDB All DBs
Position
complement(3413458..3415293)
Genome map
AA seq 611 aa AA seqDB search
MGAINPKEDYSNIQNLTFDAVIVGGGGSGMRASYQLAQAGLKVAVLTKVFPTRSHTVAAQ
GGIGASLGNMQEDNWHFHFYDTVKGSDWLGDQDAIEFMCREAPKVVYELEHLGMPFDRNA
DGTIYQRPFGGHSANYGDKPVPRACAAADRTGHALLHTLYQSNVKMGTQFFVEWIALDLI
RNEAGDVLGVTAIDQETGNIAVFQAKATLFATGGAGRVYRASTNAYINTGDGLGMAARAG
IPLQDMEFWQFHPTGVAGAGVLLTEGCRGEGAILRNKDGEPFMERYAPTLKDLAPRDFVS
RSMDQEIKEGRGCGPKGDYILLDMTHLGADTIMKRLPSVFEIGKKFANVDITKEPIPVVP
TIHYQMGGIPTNMHGQVCLPEPGTDNYTKPVKGFYAIGECSCVSVHGANRLGTNSLLDLV
VFGKAAGEHIIDYVTKHHGDEYAPLPTNVLEQTLARVRKLDESTSGENAQEVADAIRDIV
QDHAGVFRTQALLDKGVKEILALEPRVRNIHLKDKSKVFNTARVEALEVENLYEVAKATL
ISAAARKECRGAHTVVDYELPADHPTYSYGRRDDEWMKHTLWYSSDNRLEYKPVRFKPLT
VDPIPPAPRTF
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcgataaaccctaaagaagattattcaaatattcaaaacctcactttcgatgct
gttatcgttggtggtggtggttctggtatgcgtgcatcttaccaacttgctcaagcaggt
ttgaaagttgcagtacttactaaagttttcccaacacgttcacatacagttgctgctcag
ggcggtattggtgcgtcgttaggtaacatgcaagaagataactggcatttccacttttac
gatacagtaaaaggttctgactggttaggtgaccaagacgcaatcgagtttatgtgtcgt
gaggcgccaaaagttgtttatgaacttgaacacttaggtatgccgtttgaccgtaacgct
gatggtacaatttaccaacgtccattcggtggtcactctgcaaactatggtgataaacca
gttccacgtgcttgtgctgctgctgaccgtactggtcacgctttattgcacacgctttat
caaagcaacgtgaaaatgggtactcaattcttcgttgagtggatcgctcttgatttgatc
cgtaacgaagcaggtgatgtactcggtgtaactgcaattgaccaagaaactggtaacatt
gcagtattccaagcaaaagcaacattatttgcaactggtggtgctggtcgtgtttaccgt
gcatcaacaaatgcttatatcaacactggtgacggtcttggtatggctgctcgtgctggt
attccattacaagatatggaattctggcaattccaccctacaggtgttgcgggcgcaggc
gtattgttgactgaaggttgtcgtggtgaaggtgcgatccttcgtaacaaagacggcgaa
ccattcatggaacgttatgcaccaactttaaaagacttggctccgcgtgacttcgtatca
cgttctatggaccaagaaattaaagaaggtcgtggttgtggtccaaaaggtgattatatc
ttgcttgatatgactcacttgggtgctgacacaattatgaagcgtttaccatctgtattt
gagattggtaaaaaattcgcaaacgttgacatcactaaagaaccaattccagtagtacca
acaatccattatcaaatgggtggtattcctacgaatatgcatggtcaagtgtgcttacca
gagcctggtacagacaactacactaaacctgtaaaaggtttctatgcaatcggtgagtgt
tcatgcgtatcagtacatggtgcgaaccgtttaggtactaactcacttcttgacttggtt
gtatttggtaaggctgctggtgagcacattatcgattacgtaactaaacatcatggtgat
gaatatgcgccgcttccaacaaatgtattagagcaaactttagctcgtgtacgtaaattg
gatgaatcaacttctggcgaaaatgctcaagaagttgctgatgcaattcgtgatatcgtt
caagaccacgcaggtgtattccgtactcaagcattgcttgataagggtgttaaagagatt
cttgctcttgaaccacgcgtgcgtaacatccacttgaaagataaatctaaagtatttaac
actgcacgtgttgaagcgcttgaagttgaaaacttatatgaagttgcaaaagctacatta
atttcagctgctgcgcgtaaagaatgtcgtggtgcgcatacggtagttgattatgaatta
ccagctgatcacccaacttattcatacggtcgccgtgatgatgagtggatgaaacatact
ttatggtattcatcagataaccgtttggaatataagccagtgcgcttcaagccgttaact
gttgatccaattccaccagcaccacgtacattctaa

DBGET integrated database retrieval system