KEGG   Acinetobacter baumannii TYTH-1: M3Q_71Help
Entry
M3Q_71            CDS       T02261                                 

Definition
(GenBank) ddlB
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
abh00473  D-Alanine metabolism
abh00550  Peptidoglycan biosynthesis
abh01100  Metabolic pathways
abh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:abh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    M3Q_71
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    M3Q_71
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    M3Q_71
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:abh01011]
    M3Q_71
Enzymes [BR:abh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     M3Q_71
Peptidoglycan biosynthesis and degradation proteins [BR:abh01011]
 Precursor biosynthesis
  Amino acid ligase
   M3Q_71
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C CPSase_L_D2 ATP-grasp_4 ATP-grasp ATPgrasp_Ter ATP-grasp_3 ATPgrasp_YheCD RimK GARS_A TTL
Motif
Other DBs
NCBI-ProteinID: AFU36168
LinkDB All DBs
Structure
PDB: 

Position
complement(80890..81525)
Genome map
AA seq 211 aa AA seqDB search
MDKVKTKQIWQGSDLPTAPYRIITKETDLDSVIAELGLPVIIKPVHEGSSVGMSKVEKAE
DFAAAIEKATQHDAVVMAEKWITGREFTISFLNGQPLPVIRLQPPADVAFYDYEAKYQRN
DVEYGIPCGLSETEEKKLQALCLRAFQAVGAEGWGRIDAMQDEQGNFWLLEVNTVPGMTS
HSLVPKAAKAVGYSFDELCVAILEQTLEGTA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggataaagtcaaaaccaagcaaatctggcaaggaagtgatttaccaactgcaccgtat
cgcattattactaaagaaactgacttggattcagtgattgctgaattagggttgcctgtc
attatcaagcctgtacatgaaggttcaagtgtaggcatgagtaaagttgagaaagctgaa
gattttgcggcagcaattgaaaaggcaactcagcatgatgctgtagttatggcagaaaaa
tggattacaggacgcgaatttacgatttcattcttaaatggtcagcctttaccagttatt
cgtttgcagccaccagcagatgttgctttctatgactacgaagcaaaatatcaacgtaat
gatgttgagtatggcattccttgtggtcttagcgaaactgaagagaaaaaactacaagct
ctatgtttacgcgctttccaggccgtaggtgcagaaggctggggacgtattgatgcaatg
caggatgagcaaggtaacttctggcttttagaagtaaatactgtgccaggcatgaccagt
cattcgcttgtcccaaaggctgctaaagcagtaggttatagctttgatgaattgtgtgtt
gcaattcttgagcaaacattggaaggtacggcttaa

DBGET integrated database retrieval system