KEGG   Acinetobacter baumannii TYTH-1: M3Q_778Help
Entry
M3Q_778           CDS       T02261                                 

Definition
(GenBank) 3-oxoacyl-(acyl carrier protein) synthase II
  KO
K09458  3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
abh00061  Fatty acid biosynthesis
abh00780  Biotin metabolism
abh01100  Metabolic pathways
abh01212  Fatty acid metabolism
Module
abh_M00083  Fatty acid biosynthesis, elongation
abh_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:abh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    M3Q_778
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    M3Q_778
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:abh01004]
    M3Q_778
Enzymes [BR:abh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     M3Q_778
Lipid biosynthesis proteins [BR:abh01004]
 Fatty acid synthase
  Component type
   M3Q_778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N
Motif
Other DBs
NCBI-ProteinID: AFU36870
LinkDB All DBs
Position
837658..838884
Genome map
AA seq 408 aa AA seqDB search
MKRVVVTGMAGITSLGETADDIFARFEAGKSGIRYMPEWEQYVDLRTKLAGPVETFHIPK
HFNRKVTRGMGRVALMSVVCAETALQNAGLLGHEILSSGEAGVAFGSSAGSVDAVGEFAS
MLLHQSMSKINATTYIRMMAHTSAVNMTVYFGLKGLTLPTSSACTSGSMAIGQAYEAIKY
GKQQVMIAGGAEELSAAGAAVFDVLFATSGMNDQPEKTPRPFDAKRDGLVIGEGAGCLIL
EEYEHAKARGAHIYAEVIGYGSNTDGQHVTRPESEMMGRCMELALKDASVEAKDIAYVNA
HGTSTDQGDVAESQATAKVLGYKPISSLKSYFGHTLGACGAIEAWLSIEMMNRGRFIPTL
NLDEIDSLCGELDYIVQQPRNLDADIIMSNNFAFGGINTSLIFKRVKQ
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtgtagttgtgacaggaatggcaggaattacctctttaggtgaaactgccgat
gacatctttgcgcgatttgaagccggcaaaagcggtatacgttacatgccggagtgggag
caatatgttgaccttcggaccaagcttgctgggcctgttgaaacatttcatattccaaaa
cattttaaccgtaaggttacccgtggtatggggcgtgtagcactcatgtctgtggtttgt
gccgaaactgcgttacaaaatgctggtttgcttggacatgaaattttatctagtggcgaa
gcgggtgttgcctttgggtcttctgcgggtagcgtagatgccgtgggtgagtttgcaagc
atgttgcttcaccagagcatgagtaagattaatgcaaccacttatattcgcatgatggcc
cacaccagtgcggtgaacatgaccgtatattttggcctaaaaggattaactttacctacc
tcaagcgcgtgtacctctggttccatggcaattgggcaagcgtatgaagcaatcaaatat
ggtaagcaacaggtcatgattgcgggtggtgcagaggaactcagtgcggcaggtgcggca
gtttttgatgtattgttcgcgaccagtggaatgaatgatcaacctgaaaaaacaccacga
ccatttgatgctaaacgagatggattggtgattggtgaaggcgcaggctgtttaattctg
gaagaatatgaacatgccaaagcacgaggtgcccatatttatgcagaagtgattggctat
ggtagtaataccgatggtcaacatgtaactcgtcctgaatcagaaatgatggggcgctgt
atggagttagcgcttaaagatgcatctgtagaagctaaagacattgcctacgtaaatgca
catggtacttcaacagatcagggggatgtggcggagagccaagccactgcaaaagtttta
ggctataaaccaattagctctttaaagagttattttggacatacgctgggggcgtgtggg
gctattgaagcttggttaagcatcgaaatgatgaatcgtggccgttttattccaacttta
aatctagatgaaatcgactcactatgtggtgaactagattatatcgttcagcagccgaga
aatttggatgctgacattattatgagcaataactttgcttttggcggaattaatacttcg
cttatttttaaacgtgttaaacaataa

DBGET integrated database retrieval system