KEGG   Acinetobacter baumannii TYTH-1: M3Q_787Help
Entry
M3Q_787           CDS       T02261                                 

Definition
(GenBank) NADH-dependent enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
abh  Acinetobacter baumannii TYTH-1
Pathway
abh00061  Fatty acid biosynthesis
abh00780  Biotin metabolism
abh01100  Metabolic pathways
abh01130  Biosynthesis of antibiotics
abh01212  Fatty acid metabolism
Module
abh_M00083  Fatty acid biosynthesis, elongation
abh_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:abh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    M3Q_787
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    M3Q_787
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    M3Q_787
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:abh01004]
    M3Q_787
Enzymes [BR:abh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     M3Q_787
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     M3Q_787
Lipid biosynthesis proteins [BR:abh01004]
 Fatty acid synthase
  Component type
   M3Q_787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AFU36879
LinkDB All DBs
Structure
PDB: 

Position
844123..844926
Genome map
AA seq 267 aa AA seqDB search
MTQGLLAGKRFLIAGVASKLSIAYGIAQALHREGAELAFTYPNEKLKKRVDEFAEQFGSK
LVFPCDVAVDAEIDNAFAELAKHWDGVDGVVHSIGFAPAHTLDGDFTDVTDRDGFKIAHD
ISAYSFVAMARAAKPLLQARQGCLLTLTYQGSERVMPNYNVMGMAKASLEAGVRYLASSL
GVDGIRVNAISAGPIRTLAASGIKSFRKMLDANEKVAPLKRNVTIEEVGNAALFLCSPWA
SGITGEILYVDAGFNTVGMSQSMMDDE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaggacttttagcaggtaaacgctttttgattgcaggcgttgctagtaaatta
tcaattgcttatggtattgcacaagcattacaccgtgaaggtgctgagcttgcatttact
tatccaaacgaaaaattaaaaaaacgtgtagatgagtttgctgagcaattcggttctaag
cttgtgtttccatgtgatgttgccgttgatgctgaaattgataatgcatttgcggaactt
gcaaaacattgggacggcgtagacggtgttgtgcactcaatcggctttgcacctgcacac
acgcttgacggtgactttactgacgtgactgaccgtgacggttttaaaattgctcatgac
attagcgcatacagctttgttgcaatggcacgtgctgcaaaacctttattacaagctcgc
caaggttgtttattaactttgacttaccaaggttctgagcgcgttatgcctaactacaac
gtaatgggtatggcaaaagcatctttagaagctggcgttcgttacttggcatcaagtttg
ggtgttgacggtatccgtgtaaacgcaatttctgcgggtccaattcgtactttggctgct
tctggtattaaatctttccgtaaaatgctagatgctaacgaaaaagttgcgccattaaaa
cgtaacgtaaccattgaagaagtgggtaatgcagcgttattcctatgctcaccttgggct
tcaggtattactggtgaaatcctatatgtagatgctggtttcaatactgtaggtatgagc
caatctatgatggatgatgaataa

DBGET integrated database retrieval system