KEGG   Aciduliprofundum boonei: Aboo_0814Help
Entry
Aboo_0814         CDS       T01180                                 

Definition
(GenBank) DNA ligase I, ATP-dependent Dnl1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
abi  Aciduliprofundum boonei
Pathway
abi03030  DNA replication
abi03410  Base excision repair
abi03420  Nucleotide excision repair
abi03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:abi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Aboo_0814
   03410 Base excision repair
    Aboo_0814
   03420 Nucleotide excision repair
    Aboo_0814
   03430 Mismatch repair
    Aboo_0814
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:abi03032]
    Aboo_0814
   03400 DNA repair and recombination proteins [BR:abi03400]
    Aboo_0814
Enzymes [BR:abi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Aboo_0814
    6.5.1.6  DNA ligase (ATP or NAD+)
     Aboo_0814
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Aboo_0814
DNA replication proteins [BR:abi03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Aboo_0814
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Aboo_0814
DNA repair and recombination proteins [BR:abi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Aboo_0814
   NER (nucleotide excision repair)
    Other NER factors
     Aboo_0814
   MMR (mismatch exicision repair)
    Other MMR factors
     Aboo_0814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DNA_ligase_OB_2 RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: ADD08623
UniProt: B5IAL8
LinkDB All DBs
Position
778153..779925
Genome map
AA seq 590 aa AA seqDB search
MEYKIIAETYSKIESTTKRLEMTDYLVELFHNTPEDVIDKVIYLTQGKLYPDYMGIELGL
AEKLAMRGITKATGIKEKTLGEMLKKYGDLGSVAEEAIKKKRQTTLFSFEEEKNLTVEKV
YENFEKIAKAEGPGSQDRKIQLLAELLNLAKPIEAKYIVRTVEGKLRLGIADMTILDALS
IAYGRTKELRSLVERTYNIHPDLGYIAKKLAKEGIDGVKDIKIELGIPIRAMLAERLPSL
EEILAKMGGKAAFEYKYDGMRIQGHVGKDKVWLYSRRLENLTSQFPDVVEALKEAFQGKE
GIFDGEAVPVDIHTGELLPFQVVSHRRGRKYEIEKAIEDYPVVLFLFDIIYLDGEDLTSK
PYPERRKILERVINPTERVKFAHRIVSSDIGEIREFFNKAIEDGCEGLVAKSIGKESIYR
AGAREFLWIKYKRDYKVEMGDTVDLVVVGAFAGKGKRKGTYGALLMAAYNPEKDRFETVC
KLGSGFTDEQLAYLPRKFEDLKIENKHPRVWSEMEADYWFVPKVVLEVIGAEITLSPTHT
CARDVIEKGTGLAIRFPRFTGRWRDDKSPEEATTTKELIEMYKNQIKKIR
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggagtacaagattattgctgaaacttacagcaagatagaatccaccacaaagaggttg
gagatgacggattatcttgttgaacttttccataatactccggaggatgttattgataag
gttatttatctcacacagggtaagctttatcctgattatatgggtattgaactcggctta
gcggagaaattggcgatgaggggaattacgaaggcaacaggaataaaggagaaaaccctt
ggcgagatgctaaagaaatatggtgatctaggaagtgtagctgaggaagctataaagaag
aagagacagacaaccttattttcatttgaagaagagaaaaatcttactgtggagaaagtt
tatgagaactttgaaaaaattgccaaagcggaggggccgggctcacaggacaggaaaata
caacttcttgctgaattgttgaatttagcaaagccaatagaggctaagtacatagtgcgc
acggttgaaggtaaattgagattgggtatagcggatatgactattcttgatgccctttca
atagcgtatgggagaacgaaggagttgagaagtctcgtagaaaggacttacaacattcat
cctgaccttggctatattgcaaaaaaattagccaaggaggggattgatggagttaaagat
ataaagattgaactgggtatacccataagagctatgcttgccgagagattaccatccttg
gaagaaatccttgcgaagatgggaggcaaagccgcttttgaatacaagtatgatggcatg
cgtatacagggtcatgtaggaaaggataaagtatggctttattcccgaagattggagaat
ttaacatctcaatttccggatgttgtagaggccttgaaagaagcatttcaagggaaggaa
ggtatatttgatggtgaagcagtgccggtggatatacatacgggagaattgctgcctttt
caagttgtatcgcatagaaggggaagaaaatacgaaatagagaaggctattgaggattat
ccagtcgtgcttttcctctttgatataatttatctcgatggagaggacctgacatcaaaa
ccttatcctgagagaaggaaaattttagagagggttataaatcccacggaaagagttaag
ttcgcccacagaatagtttcctccgatattggtgagattagagaattcttcaacaaagcc
atagaggatggatgtgaggggctggtagcaaagagcatcggcaaggaaagtatttatcgt
gctggagctagagaatttctatggattaaatataagagagattacaaggttgaaatgggg
gacacggtagatttggtggttgtgggtgcctttgctggaaaaggaaagagaaaggggaca
tatggggctttgcttatggcagcttataatcctgagaaggataggtttgaaactgtgtgc
aagcttggctcaggatttacggatgagcaacttgcttacctacctcgcaagtttgaagac
ttaaaaattgaaaataaacatcctagagtgtggagcgaaatggaagctgactactggttc
gttcccaaagttgtgcttgaagttataggtgctgaaattaccctgagccctacacataca
tgcgctcgcgatgttattgaaaaaggcaccgggttggcaataagatttcctaggtttacg
ggtaggtggagagatgacaagagtccggaggaggccacgacaacaaaagagctaatagaa
atgtataaaaatcaaataaagaaaataaggtag

DBGET integrated database retrieval system