KEGG   Aciduliprofundum boonei: Aboo_1084Help
Entry
Aboo_1084         CDS       T01180                                 

Definition
(GenBank) ribulose bisphosphate carboxylase, type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
abi  Aciduliprofundum boonei
Pathway
abi00630  Glyoxylate and dicarboxylate metabolism
abi01100  Metabolic pathways
abi01120  Microbial metabolism in diverse environments
abi01200  Carbon metabolism
Module
abi_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:abi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Aboo_1084
Enzymes [BR:abi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Aboo_1084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N DUF1104
Motif
Other DBs
NCBI-ProteinID: ADD08893
UniProt: B5IH56
LinkDB All DBs
Position
1039257..1040519
Genome map
AA seq 420 aa AA seqDB search
MTYIDLNYQPRESDLLVWFRAEPPAGKDMKYVADRIAEESSIGTWTDLKTLLPEIWEKLR
ARVYEIDEKNKYVKIAYPLHLFEIKNMPAILASVAGNVFGMKSVEALRVLDIRFPKELIQ
GYLGPKYGVQGVREMTKVYDRPFLGTIIKPKIGLPAKMHAEVAYEAWVGGLDIVKDDENL
ASQEFNRFEERLALTLEKKDIAEEETGEKKIYLVNITAPYKEMIRRAELVQDSGNEFVMI
DVFISGFSAVQSYREEGFKMAIHAHRAMHAAITRNPEHGINMLTLAKVYRLLGVDNLHIG
TAVGKMEGSAKEVSEIREEIQLENVPANESRFEQKWYEIKPVLAVASGGLHPGHVPAVVD
ILGKDIVIQAGGGVHGHPEGTRAGAKAMREALEAKMQGIPLEEYAKEHKELREALEKFLH
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgacctacatagatttgaattatcagcccagagagagtgatttattagtttggttccgc
gctgagccacctgcaggcaaggatatgaagtatgtggcggatagaattgcggaggaatca
tccataggtacttggacagacctcaaaaccctattgcctgaaatatgggaaaaactgaga
gcaagagtatatgaaattgatgagaagaataagtatgttaaaatcgcatatccattgcat
ttatttgaaataaaaaatatgccagcaatactggcaagtgtagccggtaatgtattcggc
atgaagagcgtagaagcccttcgtgttttggatataagattcccaaaagagttgattcaa
gggtatttaggaccaaaatacggagtacaaggtgtaagggaaatgaccaaggtctatgat
agaccatttctcggcacgataatcaaacccaagataggtctacctgcgaaaatgcatgct
gaagtggcctatgaagcatgggttgggggattggatattgtcaaagatgatgaaaaccta
gcttcacaggaatttaacagatttgaagagcgtcttgccctaactctagaaaagaaagac
attgcagaggaagaaactggagagaagaagatttaccttgtgaatataactgccccctat
aaagagatgattcgccgtgcagaattagtgcaagattctggcaacgagtttgttatgatt
gatgtgttcatatctggtttctccgcggtgcaaagctacagagaggaaggttttaaaatg
gccatccatgcacatagagcgatgcatgcggcgataacaagaaatcctgagcatgggata
aatatgctcacgcttgcaaaagtgtataggcttttgggcgtggacaatttgcacataggt
acagcagtgggcaagatggaaggaagtgcaaaggaagtgagcgaaataagggaggaaata
cagcttgagaatgtgcccgcaaatgaaagcagatttgaacaaaaatggtatgaaataaaa
cccgtgctcgctgttgcttctggtggtttacatccaggccatgtccccgctgtagttgat
attttaggaaaggatatagttatccaggccggaggtggagtccatgggcatccagaaggc
actagggctggtgcgaaggcaatgcgagaggcgttagaggcgaagatgcagggtattccg
ctggaagaatacgcgaaggagcacaaagaattgagagaagcacttgaaaaattcttacac
tga

DBGET integrated database retrieval system