KEGG   Acinetobacter baumannii BJAB07104: BJAB07104_02003Help
Entry
BJAB07104_02003   CDS       T02726                                 

Definition
(GenBank) AraC-type DNA-binding domain-containing protein
  KO
K07506  AraC family transcriptional regulator
Organism
abj  Acinetobacter baumannii BJAB07104
Brite
KEGG Orthology (KO) [BR:abj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:abj03000]
    BJAB07104_02003
Transcription factors [BR:abj03000]
 Prokaryotic Type
  Helix-turn-helix
   AraC family
    BJAB07104_02003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_AraC HTH_18 DUF4160
Motif
Other DBs
NCBI-ProteinID: AGQ14371
LinkDB All DBs
Position
complement(2078030..2078884)
Genome map
AA seq 284 aa AA seqDB search
MAYQTLEQLQQSKAKLHETVVLDENMQLAFWSNQQDRVSVCSDHHTLSLYIQDGYESYQK
TPAGWKNGGGPGRFCLLPEHQESTWDIRGGLKFVHLYYTDQHLRDVAEKIWDKEPNQIEL
NEVVFNDDERIRALYQFFLLDCDWQDSSNHLQMSTTASLLLNHLIRKYSSVQWQQPTIKG
GLAPHKLKYIQEWIEDHLDQALTLSDLANIVNLSEYHFAHMFKQSMNMAPHQYVMQRRLT
KAKGLIQSSQLSLQDIALVCGFSSASHLSHRFKQFYGMSPSQLR
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggcttatcaaactttagaacagctgcagcagtctaaagccaagcttcacgaaactgtg
gtgcttgatgaaaatatgcaacttgcattttggtctaatcagcaagatcgtgtaagtgtc
tgtagcgatcaccacactctaagtctttatattcaagatggttatgaaagctatcaaaaa
acacctgcgggctggaaaaatggtggtgggccgggacgtttttgcctattgcccgaacat
caggagtcaacttgggacatacgtggtgggcttaaatttgtccacttgtactacactgac
caacatttgcgtgatgttgctgaaaaaatatgggacaaagagccgaatcaaattgaacta
aacgaagttgtatttaatgatgatgaacggattcgggcgttatatcaattcttcttgtta
gattgcgattggcaagattcttcaaatcatttgcaaatgagtacaacggcaagtttattg
ttgaatcacttaattcgaaaatatagtagtgttcaatggcaacagcctactatcaagggc
ggactggcaccccataaactcaaatatattcaggaatggattgaagatcatctagatcag
gcactcactttgtctgatttggcaaatattgtgaatttaagcgaataccattttgctcat
atgtttaaacagtccatgaatatggcgcctcaccaatatgtcatgcaaagacgcttaact
aaggccaaagggctaattcagtcatctcagctttctttgcaagatattgccctagtatgt
gggtttagttcagcaagtcatttaagtcatcgctttaaacaattttatggcatgagtcct
tcgcagttacgttaa

DBGET integrated database retrieval system